Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2V421

Protein Details
Accession A0A1M2V421   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-105WCPGQEPQRRERERRWRWRNASQMVGEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MVRLNVGNDEAASVVGGTKMKPESKPPARGSQGLAKADWATVWLPGIPSKTKVTTEPLVTLTDEGTYEAAYVVESGLPWCPGQEPQRRERERRWRWRNASQMVGETE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.07
4 0.07
5 0.1
6 0.14
7 0.18
8 0.19
9 0.26
10 0.35
11 0.43
12 0.52
13 0.53
14 0.58
15 0.59
16 0.59
17 0.56
18 0.54
19 0.51
20 0.43
21 0.39
22 0.31
23 0.27
24 0.25
25 0.21
26 0.14
27 0.08
28 0.07
29 0.07
30 0.06
31 0.06
32 0.08
33 0.1
34 0.1
35 0.12
36 0.14
37 0.15
38 0.16
39 0.17
40 0.2
41 0.2
42 0.21
43 0.2
44 0.19
45 0.18
46 0.17
47 0.16
48 0.12
49 0.09
50 0.08
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06
66 0.06
67 0.08
68 0.13
69 0.21
70 0.3
71 0.35
72 0.43
73 0.54
74 0.61
75 0.66
76 0.71
77 0.74
78 0.76
79 0.82
80 0.83
81 0.84
82 0.86
83 0.89
84 0.88
85 0.84
86 0.8
87 0.72