Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2W7K2

Protein Details
Accession A0A1M2W7K2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLAVTKKKRPQLTKRHREKRYAFALHydrophilic
NLS Segment(s)
PositionSequence
6-20KKKRPQLTKRHREKR
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MLAVTKKKRPQLTKRHREKRYAFALAKKYWTVEDWKRVVWSDETKINRVGSDGRKWVWKKRGEGLSDRLVEGTLKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.92
3 0.89
4 0.89
5 0.84
6 0.81
7 0.78
8 0.76
9 0.68
10 0.65
11 0.65
12 0.57
13 0.54
14 0.45
15 0.37
16 0.29
17 0.27
18 0.27
19 0.25
20 0.3
21 0.28
22 0.29
23 0.29
24 0.28
25 0.28
26 0.24
27 0.23
28 0.18
29 0.23
30 0.25
31 0.26
32 0.28
33 0.27
34 0.23
35 0.21
36 0.25
37 0.24
38 0.27
39 0.29
40 0.28
41 0.36
42 0.39
43 0.47
44 0.49
45 0.51
46 0.51
47 0.56
48 0.63
49 0.59
50 0.63
51 0.6
52 0.6
53 0.54
54 0.5
55 0.41
56 0.34