Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VM53

Protein Details
Accession A0A1M2VM53    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
136-155SGKSRKRGKMPKPQNAPPKFBasic
NLS Segment(s)
PositionSequence
137-157GKSRKRGKMPKPQNAPPKFKK
Subcellular Location(s) nucl 13, cyto_nucl 12.333, cyto 9.5, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MAQSGPSILDVHTPTSSFAIIYSDPEDSLETLFDKLSKKTVSELNGRHVRPGWVKYEWNSTVWNMDDASDYAIFAWRLKSATPGGEGWPILFVRNPDSSLPSPSEYQNPSFYMFRPKPTPYSPQLPSTPESSSAASGKSRKRGKMPKPQNAPPKFKKEFEKFHNENGVRTISGSIGPVNNVRMLLKTGYRHVYISRKFAIKNGFIPRDAAPGHYGYSGIVNLGKWPVTVGRTRTVHSVYLTEESHFDVILGRSFVERRQVKFDPVDPTDVVCGDTGEKIDCELVILKDGKGQIVTVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.14
5 0.13
6 0.13
7 0.12
8 0.15
9 0.15
10 0.15
11 0.14
12 0.15
13 0.16
14 0.13
15 0.13
16 0.12
17 0.1
18 0.1
19 0.11
20 0.13
21 0.15
22 0.16
23 0.21
24 0.22
25 0.22
26 0.25
27 0.3
28 0.33
29 0.39
30 0.42
31 0.45
32 0.52
33 0.51
34 0.5
35 0.47
36 0.47
37 0.44
38 0.44
39 0.4
40 0.36
41 0.39
42 0.39
43 0.46
44 0.42
45 0.37
46 0.35
47 0.31
48 0.3
49 0.27
50 0.25
51 0.16
52 0.15
53 0.15
54 0.13
55 0.15
56 0.11
57 0.1
58 0.09
59 0.11
60 0.11
61 0.1
62 0.11
63 0.1
64 0.1
65 0.11
66 0.14
67 0.14
68 0.15
69 0.17
70 0.17
71 0.17
72 0.19
73 0.18
74 0.15
75 0.15
76 0.14
77 0.12
78 0.12
79 0.11
80 0.12
81 0.14
82 0.15
83 0.14
84 0.19
85 0.2
86 0.22
87 0.23
88 0.21
89 0.22
90 0.22
91 0.26
92 0.24
93 0.25
94 0.25
95 0.24
96 0.24
97 0.24
98 0.23
99 0.28
100 0.27
101 0.29
102 0.31
103 0.32
104 0.34
105 0.37
106 0.42
107 0.36
108 0.42
109 0.41
110 0.4
111 0.41
112 0.39
113 0.36
114 0.32
115 0.29
116 0.23
117 0.22
118 0.18
119 0.17
120 0.15
121 0.14
122 0.14
123 0.19
124 0.21
125 0.28
126 0.33
127 0.34
128 0.43
129 0.52
130 0.58
131 0.64
132 0.71
133 0.72
134 0.75
135 0.79
136 0.81
137 0.78
138 0.78
139 0.73
140 0.72
141 0.66
142 0.62
143 0.64
144 0.61
145 0.61
146 0.59
147 0.63
148 0.55
149 0.57
150 0.62
151 0.53
152 0.46
153 0.4
154 0.35
155 0.24
156 0.23
157 0.19
158 0.1
159 0.1
160 0.1
161 0.08
162 0.07
163 0.08
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.1
171 0.11
172 0.13
173 0.14
174 0.17
175 0.2
176 0.2
177 0.21
178 0.23
179 0.31
180 0.31
181 0.34
182 0.34
183 0.35
184 0.34
185 0.38
186 0.39
187 0.33
188 0.37
189 0.41
190 0.39
191 0.36
192 0.39
193 0.35
194 0.33
195 0.31
196 0.25
197 0.19
198 0.17
199 0.18
200 0.15
201 0.15
202 0.1
203 0.11
204 0.1
205 0.08
206 0.08
207 0.07
208 0.08
209 0.09
210 0.09
211 0.08
212 0.09
213 0.1
214 0.12
215 0.17
216 0.19
217 0.26
218 0.28
219 0.3
220 0.33
221 0.34
222 0.33
223 0.3
224 0.28
225 0.23
226 0.25
227 0.24
228 0.2
229 0.19
230 0.18
231 0.17
232 0.15
233 0.13
234 0.11
235 0.11
236 0.13
237 0.12
238 0.11
239 0.13
240 0.14
241 0.16
242 0.23
243 0.27
244 0.29
245 0.36
246 0.39
247 0.43
248 0.46
249 0.5
250 0.48
251 0.45
252 0.46
253 0.39
254 0.37
255 0.33
256 0.29
257 0.24
258 0.16
259 0.15
260 0.11
261 0.12
262 0.12
263 0.12
264 0.12
265 0.12
266 0.12
267 0.11
268 0.12
269 0.13
270 0.13
271 0.17
272 0.18
273 0.18
274 0.21
275 0.22
276 0.22
277 0.19