Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2W3G6

Protein Details
Accession A0A1M2W3G6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-28TSFISFPSGRPRKRPKIERDSDDTIHydrophilic
NLS Segment(s)
PositionSequence
14-18PRKRP
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MAETSFISFPSGRPRKRPKIERDSDDTILPDLPLLEIDRPLWLADGNVVIIAQSQTAFRVHKSVLLRHSDAFKTLLAVAEPTFGETSKVEGCPVVHTEDTAHDFKHLLHALYDGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.74
4 0.83
5 0.83
6 0.84
7 0.89
8 0.86
9 0.83
10 0.79
11 0.7
12 0.61
13 0.51
14 0.41
15 0.32
16 0.24
17 0.16
18 0.09
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.08
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.07
45 0.07
46 0.09
47 0.09
48 0.14
49 0.16
50 0.19
51 0.22
52 0.26
53 0.28
54 0.26
55 0.3
56 0.26
57 0.25
58 0.22
59 0.17
60 0.14
61 0.13
62 0.12
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.11
74 0.13
75 0.13
76 0.12
77 0.13
78 0.13
79 0.15
80 0.17
81 0.18
82 0.15
83 0.15
84 0.16
85 0.19
86 0.23
87 0.22
88 0.2
89 0.17
90 0.18
91 0.18
92 0.25
93 0.24
94 0.2
95 0.19
96 0.2