Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VKY8

Protein Details
Accession A0A1M2VKY8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
87-109LFSKSPSPSRRSRKSARAAAPTMHydrophilic
544-567ANLPRLRKIKAKYDPKKVWSKGFVHydrophilic
NLS Segment(s)
PositionSequence
94-101PSRRSRKS
Subcellular Location(s) mito 16, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012951  BBE  
IPR016166  FAD-bd_PCMH  
IPR036318  FAD-bd_PCMH-like_sf  
IPR016167  FAD-bd_PCMH_sub1  
IPR016169  FAD-bd_PCMH_sub2  
IPR006094  Oxid_FAD_bind_N  
Gene Ontology GO:0071949  F:FAD binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF08031  BBE  
PF01565  FAD_binding_4  
PROSITE View protein in PROSITE  
PS51387  FAD_PCMH  
Amino Acid Sequences MAGKVTKTVCFSIKADRHLHSLRPSKLLSAMRHTSSPGMRGWRPHAIRFPRRAQSTDSPKPPCLAQLTEPPPAPTPAHAIMRRLRSLFSKSPSPSRRSRKSARAAAPTMADLQSKIKGTVLTPESGDAYTAALRRNSDLSVLPAKLVVQPAVYEDIPSVIAYATGQSPPLEIAVKGGGAHSSTWASSDGGVVIDLGKLNKVTLAEDKQSVSVQGGALWGDVYEVTSKAQVDVVGSPLWFVGVGGYTLGGGYGPLSGEYGLAIDNILSATVVLADGRIVKTSKDEEPDLFWAIRGGGGQFGIVVEFVFKTHPYAGPFGSGVIAFPGTELASILQIIKEWKATHTPAERFTLNFSRPAPHFKPSIVFLPSVLHDTDGARSKTVLAPFREGPVKPAFEKIATVPDFLTVSHAADASLASAPKRLAIRGTFFSDFYPELLQAVWDKWVAFTETSEEVRGSAVLWDLTSPAKLMEVGADETALKVREPHYWMAVQGRSTTDASVDAARAFTADVVQLVREKNTELSGRDLGWFVNLSNGTEKAEDVFGANLPRLRKIKAKYDPKKVWSKGFVIEPLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.47
4 0.52
5 0.52
6 0.56
7 0.55
8 0.58
9 0.55
10 0.55
11 0.53
12 0.48
13 0.52
14 0.53
15 0.48
16 0.47
17 0.49
18 0.46
19 0.46
20 0.45
21 0.44
22 0.39
23 0.37
24 0.33
25 0.35
26 0.35
27 0.4
28 0.44
29 0.48
30 0.5
31 0.53
32 0.59
33 0.62
34 0.68
35 0.71
36 0.74
37 0.73
38 0.73
39 0.7
40 0.67
41 0.67
42 0.68
43 0.69
44 0.69
45 0.66
46 0.63
47 0.62
48 0.55
49 0.49
50 0.44
51 0.38
52 0.33
53 0.38
54 0.41
55 0.44
56 0.45
57 0.42
58 0.39
59 0.38
60 0.35
61 0.26
62 0.28
63 0.27
64 0.35
65 0.35
66 0.38
67 0.41
68 0.47
69 0.49
70 0.44
71 0.41
72 0.38
73 0.44
74 0.45
75 0.44
76 0.46
77 0.46
78 0.55
79 0.6
80 0.61
81 0.64
82 0.67
83 0.72
84 0.72
85 0.78
86 0.78
87 0.8
88 0.84
89 0.82
90 0.81
91 0.74
92 0.67
93 0.59
94 0.5
95 0.43
96 0.34
97 0.26
98 0.18
99 0.17
100 0.19
101 0.18
102 0.18
103 0.17
104 0.16
105 0.16
106 0.24
107 0.24
108 0.21
109 0.2
110 0.21
111 0.21
112 0.19
113 0.19
114 0.11
115 0.1
116 0.11
117 0.13
118 0.15
119 0.15
120 0.16
121 0.17
122 0.19
123 0.18
124 0.17
125 0.16
126 0.18
127 0.22
128 0.21
129 0.19
130 0.18
131 0.18
132 0.18
133 0.19
134 0.15
135 0.1
136 0.1
137 0.11
138 0.14
139 0.13
140 0.11
141 0.1
142 0.1
143 0.1
144 0.1
145 0.09
146 0.05
147 0.05
148 0.05
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.08
156 0.09
157 0.09
158 0.07
159 0.08
160 0.08
161 0.08
162 0.08
163 0.08
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.08
171 0.09
172 0.09
173 0.08
174 0.09
175 0.08
176 0.07
177 0.07
178 0.06
179 0.05
180 0.05
181 0.06
182 0.05
183 0.06
184 0.06
185 0.06
186 0.07
187 0.07
188 0.08
189 0.13
190 0.16
191 0.18
192 0.19
193 0.2
194 0.2
195 0.2
196 0.18
197 0.14
198 0.11
199 0.09
200 0.08
201 0.08
202 0.07
203 0.06
204 0.06
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.05
211 0.05
212 0.07
213 0.07
214 0.07
215 0.08
216 0.07
217 0.08
218 0.08
219 0.09
220 0.08
221 0.08
222 0.08
223 0.07
224 0.07
225 0.05
226 0.05
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.02
237 0.02
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.02
254 0.02
255 0.02
256 0.02
257 0.02
258 0.02
259 0.02
260 0.03
261 0.04
262 0.04
263 0.06
264 0.06
265 0.06
266 0.08
267 0.11
268 0.14
269 0.15
270 0.16
271 0.16
272 0.18
273 0.2
274 0.19
275 0.16
276 0.14
277 0.11
278 0.1
279 0.1
280 0.07
281 0.06
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.04
294 0.04
295 0.06
296 0.07
297 0.09
298 0.11
299 0.12
300 0.12
301 0.13
302 0.13
303 0.12
304 0.11
305 0.09
306 0.07
307 0.06
308 0.05
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.05
321 0.06
322 0.06
323 0.08
324 0.09
325 0.1
326 0.14
327 0.15
328 0.2
329 0.27
330 0.29
331 0.29
332 0.32
333 0.31
334 0.28
335 0.31
336 0.31
337 0.25
338 0.26
339 0.25
340 0.26
341 0.26
342 0.34
343 0.32
344 0.29
345 0.3
346 0.27
347 0.29
348 0.27
349 0.3
350 0.23
351 0.21
352 0.18
353 0.18
354 0.18
355 0.18
356 0.15
357 0.11
358 0.1
359 0.1
360 0.13
361 0.18
362 0.18
363 0.16
364 0.16
365 0.18
366 0.21
367 0.25
368 0.27
369 0.23
370 0.27
371 0.28
372 0.31
373 0.33
374 0.3
375 0.29
376 0.28
377 0.29
378 0.25
379 0.28
380 0.26
381 0.22
382 0.23
383 0.2
384 0.24
385 0.22
386 0.21
387 0.18
388 0.18
389 0.18
390 0.17
391 0.19
392 0.11
393 0.11
394 0.11
395 0.1
396 0.09
397 0.09
398 0.09
399 0.07
400 0.08
401 0.08
402 0.07
403 0.09
404 0.09
405 0.13
406 0.14
407 0.13
408 0.16
409 0.18
410 0.23
411 0.25
412 0.3
413 0.28
414 0.28
415 0.28
416 0.26
417 0.24
418 0.2
419 0.18
420 0.12
421 0.11
422 0.11
423 0.11
424 0.1
425 0.1
426 0.1
427 0.09
428 0.09
429 0.09
430 0.11
431 0.12
432 0.11
433 0.11
434 0.13
435 0.16
436 0.17
437 0.17
438 0.16
439 0.14
440 0.14
441 0.13
442 0.1
443 0.08
444 0.08
445 0.07
446 0.07
447 0.07
448 0.08
449 0.09
450 0.08
451 0.08
452 0.07
453 0.07
454 0.07
455 0.07
456 0.08
457 0.09
458 0.1
459 0.1
460 0.1
461 0.1
462 0.1
463 0.12
464 0.11
465 0.09
466 0.1
467 0.12
468 0.18
469 0.22
470 0.25
471 0.26
472 0.27
473 0.29
474 0.33
475 0.34
476 0.29
477 0.27
478 0.26
479 0.25
480 0.25
481 0.23
482 0.17
483 0.16
484 0.16
485 0.16
486 0.15
487 0.12
488 0.11
489 0.11
490 0.1
491 0.09
492 0.08
493 0.07
494 0.07
495 0.07
496 0.08
497 0.09
498 0.12
499 0.14
500 0.15
501 0.15
502 0.16
503 0.17
504 0.21
505 0.24
506 0.23
507 0.27
508 0.28
509 0.28
510 0.27
511 0.26
512 0.21
513 0.2
514 0.18
515 0.13
516 0.17
517 0.16
518 0.17
519 0.19
520 0.2
521 0.2
522 0.2
523 0.2
524 0.16
525 0.16
526 0.14
527 0.12
528 0.13
529 0.13
530 0.15
531 0.17
532 0.18
533 0.19
534 0.26
535 0.28
536 0.31
537 0.37
538 0.42
539 0.5
540 0.58
541 0.67
542 0.7
543 0.78
544 0.83
545 0.84
546 0.88
547 0.83
548 0.82
549 0.77
550 0.72
551 0.66
552 0.62
553 0.58