Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W389

Protein Details
Accession A0A1M2W389    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-103DNELQSTPSRKRRRRRFPILNLLELHydrophilic
NLS Segment(s)
PositionSequence
88-94RKRRRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPNLPLEKIPPMIPVEEHCWCDISNGAFSPANLTKWEEASVSRLAENLEHAIAAEKEAERRRQCEVVDGEAKTNGTSCDNELQSTPSRKRRRRRFPILNLLELLGPSSFHKTPPRSTNDTLLSPQEREETSIPQQASVRLPWFRREYDLRRFGFAMVLDFGWPGSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.27
4 0.28
5 0.25
6 0.25
7 0.23
8 0.23
9 0.23
10 0.19
11 0.17
12 0.16
13 0.19
14 0.18
15 0.18
16 0.23
17 0.22
18 0.21
19 0.2
20 0.22
21 0.2
22 0.21
23 0.22
24 0.16
25 0.15
26 0.17
27 0.18
28 0.16
29 0.15
30 0.14
31 0.14
32 0.13
33 0.14
34 0.11
35 0.09
36 0.08
37 0.08
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.13
44 0.17
45 0.25
46 0.25
47 0.28
48 0.31
49 0.33
50 0.33
51 0.35
52 0.33
53 0.31
54 0.33
55 0.31
56 0.28
57 0.25
58 0.25
59 0.18
60 0.16
61 0.11
62 0.08
63 0.08
64 0.09
65 0.13
66 0.13
67 0.14
68 0.13
69 0.15
70 0.18
71 0.23
72 0.28
73 0.33
74 0.43
75 0.51
76 0.61
77 0.69
78 0.77
79 0.81
80 0.87
81 0.88
82 0.88
83 0.91
84 0.84
85 0.75
86 0.64
87 0.54
88 0.43
89 0.31
90 0.22
91 0.11
92 0.08
93 0.07
94 0.11
95 0.11
96 0.13
97 0.21
98 0.24
99 0.3
100 0.38
101 0.44
102 0.47
103 0.49
104 0.53
105 0.5
106 0.49
107 0.44
108 0.42
109 0.37
110 0.3
111 0.29
112 0.25
113 0.21
114 0.22
115 0.22
116 0.22
117 0.24
118 0.29
119 0.28
120 0.27
121 0.28
122 0.27
123 0.28
124 0.26
125 0.27
126 0.27
127 0.3
128 0.35
129 0.38
130 0.37
131 0.41
132 0.47
133 0.5
134 0.55
135 0.61
136 0.56
137 0.55
138 0.54
139 0.48
140 0.42
141 0.35
142 0.27
143 0.2
144 0.19
145 0.15
146 0.14
147 0.14