Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2V5U7

Protein Details
Accession A0A1M2V5U7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
379-398VPGWPRYKLRIKVRVGNKDKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_mito 11.166, mito 9.5, cyto_nucl 9.333, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040976  Pkinase_fungal  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MRTTVLVKWKDFQSDILPAIPVKQPPLATLPNKVVSDAKGTLSKLFYGDQSNPKKLLNVKEDDIADTVVDVINAAMSALELPKEHLRYKAALSRYKANPSDEMRSKVDAAIYEEDDAPTNDNQWPDWTNCRFYIELKRGDVKYDLWDDCSLKVAENESHTRANVRAQLIAYTKNVFLYQHRTALFSLLIIGNSFRAARWDRSGAIVSKKVNYVDEPQSLLDFICHLVQLEPTLQGLDPTADLIELGMKAFRVMNELAEPNSELDMEYMEPGTENYIPPPAHPPPTESAPDGVSEPSGSVAAGTAPQQGVTPPAGAPKTRTRGKQPASAKPHVTQDLPTGIQDAKEDPDDDLPTGKFESVDGEDPHVFRYVREKFRESLVPGWPRYKLRIKVRVGNKDKVRVFLVAKPLFEAPSMFGRATRGYVAIDVRTGRFVFLKDSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.33
4 0.3
5 0.25
6 0.27
7 0.28
8 0.24
9 0.22
10 0.24
11 0.23
12 0.24
13 0.3
14 0.35
15 0.34
16 0.38
17 0.41
18 0.44
19 0.43
20 0.43
21 0.39
22 0.32
23 0.36
24 0.32
25 0.29
26 0.27
27 0.28
28 0.3
29 0.28
30 0.28
31 0.23
32 0.23
33 0.22
34 0.23
35 0.29
36 0.35
37 0.42
38 0.45
39 0.46
40 0.45
41 0.47
42 0.48
43 0.51
44 0.49
45 0.47
46 0.44
47 0.47
48 0.48
49 0.44
50 0.39
51 0.3
52 0.21
53 0.16
54 0.14
55 0.09
56 0.08
57 0.06
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.06
68 0.09
69 0.15
70 0.19
71 0.2
72 0.23
73 0.26
74 0.28
75 0.32
76 0.36
77 0.38
78 0.41
79 0.43
80 0.48
81 0.5
82 0.56
83 0.55
84 0.51
85 0.51
86 0.49
87 0.54
88 0.5
89 0.51
90 0.45
91 0.44
92 0.42
93 0.36
94 0.33
95 0.25
96 0.23
97 0.21
98 0.2
99 0.19
100 0.18
101 0.17
102 0.17
103 0.16
104 0.14
105 0.11
106 0.12
107 0.13
108 0.13
109 0.13
110 0.15
111 0.18
112 0.18
113 0.26
114 0.27
115 0.29
116 0.29
117 0.32
118 0.29
119 0.31
120 0.38
121 0.37
122 0.38
123 0.38
124 0.43
125 0.4
126 0.42
127 0.39
128 0.31
129 0.28
130 0.29
131 0.26
132 0.23
133 0.25
134 0.24
135 0.22
136 0.24
137 0.2
138 0.15
139 0.15
140 0.15
141 0.15
142 0.18
143 0.21
144 0.2
145 0.21
146 0.21
147 0.22
148 0.2
149 0.22
150 0.23
151 0.2
152 0.19
153 0.18
154 0.22
155 0.22
156 0.23
157 0.2
158 0.17
159 0.16
160 0.15
161 0.15
162 0.13
163 0.14
164 0.19
165 0.2
166 0.23
167 0.23
168 0.24
169 0.24
170 0.24
171 0.22
172 0.14
173 0.13
174 0.09
175 0.08
176 0.07
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.08
183 0.11
184 0.13
185 0.16
186 0.18
187 0.18
188 0.2
189 0.22
190 0.21
191 0.21
192 0.23
193 0.21
194 0.21
195 0.22
196 0.2
197 0.19
198 0.18
199 0.2
200 0.2
201 0.2
202 0.2
203 0.18
204 0.18
205 0.17
206 0.15
207 0.1
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.05
224 0.05
225 0.04
226 0.04
227 0.04
228 0.04
229 0.03
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.07
239 0.08
240 0.08
241 0.1
242 0.11
243 0.11
244 0.11
245 0.11
246 0.09
247 0.09
248 0.08
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.05
255 0.05
256 0.05
257 0.05
258 0.07
259 0.07
260 0.07
261 0.07
262 0.12
263 0.12
264 0.13
265 0.19
266 0.2
267 0.24
268 0.24
269 0.27
270 0.26
271 0.3
272 0.31
273 0.26
274 0.24
275 0.2
276 0.2
277 0.18
278 0.15
279 0.11
280 0.09
281 0.08
282 0.07
283 0.06
284 0.05
285 0.04
286 0.04
287 0.04
288 0.05
289 0.06
290 0.07
291 0.07
292 0.07
293 0.08
294 0.08
295 0.1
296 0.1
297 0.1
298 0.08
299 0.13
300 0.14
301 0.15
302 0.19
303 0.26
304 0.33
305 0.38
306 0.42
307 0.47
308 0.56
309 0.6
310 0.64
311 0.63
312 0.65
313 0.68
314 0.7
315 0.65
316 0.58
317 0.6
318 0.54
319 0.47
320 0.38
321 0.33
322 0.31
323 0.28
324 0.25
325 0.21
326 0.18
327 0.18
328 0.17
329 0.15
330 0.13
331 0.14
332 0.15
333 0.14
334 0.17
335 0.17
336 0.17
337 0.18
338 0.16
339 0.17
340 0.17
341 0.16
342 0.12
343 0.11
344 0.15
345 0.15
346 0.19
347 0.19
348 0.22
349 0.24
350 0.24
351 0.25
352 0.25
353 0.22
354 0.18
355 0.27
356 0.32
357 0.39
358 0.45
359 0.47
360 0.45
361 0.5
362 0.56
363 0.5
364 0.47
365 0.47
366 0.49
367 0.48
368 0.5
369 0.5
370 0.46
371 0.5
372 0.54
373 0.54
374 0.57
375 0.64
376 0.67
377 0.71
378 0.78
379 0.81
380 0.79
381 0.8
382 0.76
383 0.76
384 0.72
385 0.66
386 0.59
387 0.53
388 0.49
389 0.45
390 0.48
391 0.42
392 0.4
393 0.38
394 0.37
395 0.33
396 0.3
397 0.25
398 0.18
399 0.2
400 0.23
401 0.21
402 0.2
403 0.22
404 0.24
405 0.25
406 0.23
407 0.19
408 0.17
409 0.2
410 0.22
411 0.2
412 0.22
413 0.22
414 0.22
415 0.25
416 0.24
417 0.22
418 0.22
419 0.22