Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YAZ7

Protein Details
Accession G8YAZ7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
87-113PGGLPNFASRHRRKRRAHAWWRLPLCDHydrophilic
NLS Segment(s)
PositionSequence
24-31GRPHRRGR
96-103RHRRKRRA
Subcellular Location(s) nucl 9, mito 8, extr 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MAACQRPPPGPVCWLLEGSGAKSGRPHRRGRAARGACLCERSAASQLLGASSAPSEAFLAASAFATCKGGRVSAAGYTRRRLAAVVPGGLPNFASRHRRKRRAHAWWRLPLCDLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.28
4 0.25
5 0.23
6 0.25
7 0.21
8 0.18
9 0.23
10 0.31
11 0.37
12 0.44
13 0.5
14 0.51
15 0.62
16 0.69
17 0.72
18 0.74
19 0.67
20 0.67
21 0.64
22 0.6
23 0.51
24 0.46
25 0.38
26 0.29
27 0.26
28 0.21
29 0.19
30 0.16
31 0.14
32 0.13
33 0.13
34 0.12
35 0.11
36 0.09
37 0.06
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.06
53 0.05
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.09
60 0.12
61 0.17
62 0.22
63 0.24
64 0.25
65 0.27
66 0.27
67 0.26
68 0.22
69 0.19
70 0.21
71 0.22
72 0.22
73 0.2
74 0.21
75 0.21
76 0.2
77 0.19
78 0.12
79 0.11
80 0.15
81 0.24
82 0.32
83 0.43
84 0.55
85 0.65
86 0.72
87 0.81
88 0.87
89 0.89
90 0.91
91 0.91
92 0.9
93 0.9
94 0.86
95 0.77