Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W4L4

Protein Details
Accession A0A1M2W4L4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-29ATPKRGRKLKHITRKAEEILBasic
NLS Segment(s)
PositionSequence
14-19RGRKLK
Subcellular Location(s) nucl 10, cyto 10, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MYRVDLFDTATPKRGRKLKHITRKAEEILEPGEEYEPPEDRLPRKTATVHMLTDTVGSNRIKNAYAAYGNEASMDIMYVGMCLIVDIGPAGQRNNVDADRWTRKKHGVEASDSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.51
4 0.61
5 0.64
6 0.71
7 0.78
8 0.79
9 0.79
10 0.8
11 0.72
12 0.65
13 0.55
14 0.46
15 0.37
16 0.29
17 0.23
18 0.18
19 0.15
20 0.11
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.17
27 0.19
28 0.23
29 0.25
30 0.25
31 0.26
32 0.26
33 0.27
34 0.28
35 0.29
36 0.25
37 0.23
38 0.22
39 0.19
40 0.18
41 0.15
42 0.1
43 0.11
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.11
53 0.11
54 0.14
55 0.13
56 0.13
57 0.12
58 0.12
59 0.09
60 0.08
61 0.07
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.02
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.05
76 0.07
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.18
85 0.26
86 0.35
87 0.4
88 0.44
89 0.45
90 0.52
91 0.56
92 0.61
93 0.63
94 0.58