Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2V739

Protein Details
Accession A0A1M2V739   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-161DLEKADKSRRRLDQEKRKQVKRGRSKGGDWBasic
NLS Segment(s)
PositionSequence
127-158RKRVRDLEKADKSRRRLDQEKRKQVKRGRSKG
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MKDIPRHAVELTFSRSSGPGGQNVNKVNTKATLRCPLDTPWIPLWARDYLKHTPAYASSSQSVLITSTVHRSQAQNVQDCLAKASTPGSSVRDASSSHFDPRSLQLHTLIVSAASAGLVNEPSEEQRKRVRDLEKADKSRRRLDQEKRKQVKRGRSKGGDWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.27
5 0.24
6 0.23
7 0.28
8 0.33
9 0.37
10 0.4
11 0.43
12 0.4
13 0.39
14 0.35
15 0.34
16 0.35
17 0.33
18 0.36
19 0.4
20 0.4
21 0.41
22 0.42
23 0.39
24 0.43
25 0.41
26 0.4
27 0.32
28 0.35
29 0.33
30 0.32
31 0.32
32 0.29
33 0.29
34 0.26
35 0.29
36 0.28
37 0.31
38 0.32
39 0.29
40 0.25
41 0.24
42 0.27
43 0.23
44 0.21
45 0.19
46 0.18
47 0.18
48 0.16
49 0.15
50 0.1
51 0.09
52 0.07
53 0.07
54 0.11
55 0.11
56 0.12
57 0.13
58 0.14
59 0.17
60 0.22
61 0.26
62 0.25
63 0.25
64 0.25
65 0.24
66 0.24
67 0.22
68 0.15
69 0.11
70 0.08
71 0.08
72 0.07
73 0.08
74 0.09
75 0.1
76 0.11
77 0.12
78 0.12
79 0.12
80 0.13
81 0.14
82 0.18
83 0.18
84 0.2
85 0.2
86 0.19
87 0.2
88 0.23
89 0.24
90 0.2
91 0.2
92 0.18
93 0.18
94 0.19
95 0.17
96 0.13
97 0.09
98 0.08
99 0.07
100 0.05
101 0.04
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.05
108 0.06
109 0.08
110 0.16
111 0.17
112 0.2
113 0.28
114 0.32
115 0.36
116 0.43
117 0.46
118 0.47
119 0.55
120 0.63
121 0.65
122 0.7
123 0.75
124 0.75
125 0.76
126 0.76
127 0.76
128 0.74
129 0.74
130 0.76
131 0.78
132 0.81
133 0.87
134 0.88
135 0.87
136 0.88
137 0.87
138 0.87
139 0.86
140 0.85
141 0.85
142 0.82