Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2V6S2

Protein Details
Accession A0A1M2V6S2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-76AAWQEEYEKRKKKRSVQKMSEARAEIHydrophilic
NLS Segment(s)
PositionSequence
59-64KRKKKR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences MSDSTTSRSGRFPKLNDKNYVEWAMRMEAELVRHKLWDGIVEITLDVQDPAAWQEEYEKRKKKRSVQKMSEARAEIIMQVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.68
4 0.67
5 0.62
6 0.6
7 0.58
8 0.48
9 0.38
10 0.33
11 0.26
12 0.21
13 0.18
14 0.14
15 0.11
16 0.13
17 0.17
18 0.18
19 0.16
20 0.16
21 0.16
22 0.16
23 0.15
24 0.14
25 0.11
26 0.09
27 0.09
28 0.09
29 0.09
30 0.08
31 0.07
32 0.06
33 0.04
34 0.03
35 0.03
36 0.03
37 0.04
38 0.06
39 0.06
40 0.06
41 0.12
42 0.19
43 0.25
44 0.34
45 0.42
46 0.47
47 0.57
48 0.65
49 0.7
50 0.74
51 0.8
52 0.82
53 0.83
54 0.87
55 0.87
56 0.84
57 0.81
58 0.72
59 0.62
60 0.52
61 0.43
62 0.33