Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2V2T3

Protein Details
Accession A0A1M2V2T3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
31-50RNCPKKPTGKGKQLVRKNRTBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, cyto 7, cyto_pero 4.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MDVDRMTAEERDRHYKEGRCFNCHEVGHLSRNCPKKPTGKGKQLVRKNRTMEAEEEPVEESNGEDSNVDTRTLVTARIRTALQGINDPVEKKGMLSEFLGEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.55
4 0.61
5 0.6
6 0.57
7 0.58
8 0.58
9 0.59
10 0.51
11 0.46
12 0.41
13 0.4
14 0.42
15 0.39
16 0.39
17 0.38
18 0.45
19 0.43
20 0.4
21 0.41
22 0.42
23 0.5
24 0.57
25 0.6
26 0.63
27 0.69
28 0.75
29 0.79
30 0.8
31 0.8
32 0.74
33 0.72
34 0.65
35 0.62
36 0.56
37 0.48
38 0.42
39 0.35
40 0.33
41 0.26
42 0.24
43 0.2
44 0.17
45 0.15
46 0.12
47 0.08
48 0.06
49 0.06
50 0.06
51 0.05
52 0.06
53 0.08
54 0.09
55 0.09
56 0.08
57 0.08
58 0.1
59 0.1
60 0.12
61 0.13
62 0.15
63 0.16
64 0.18
65 0.18
66 0.16
67 0.19
68 0.2
69 0.18
70 0.2
71 0.2
72 0.21
73 0.24
74 0.24
75 0.22
76 0.2
77 0.19
78 0.15
79 0.19
80 0.17
81 0.17
82 0.17
83 0.18