Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2V8F0

Protein Details
Accession A0A1M2V8F0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-114ALRTRRSRTTRRTFKRSVKKAKEQFYEHydrophilic
NLS Segment(s)
PositionSequence
92-109RRSRTTRRTFKRSVKKAK
Subcellular Location(s) nucl 11.5, cyto_nucl 10, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences TTRVGWWEQTLPPNIKRKSPAEKEFLEELVNAVAAVRVELSTIVDIQRTCDEIMAAVRRSWDAHAEAPRPSSRAKRWWNQTCTDELEALRTRRSRTTRRTFKRSVKKAKEQFYEERIAAAREKGKRVWDVVSWTNPRALPMYKALVHDGRLLVELDDLWSAVDATYNSAAHRAVDMSFLDDMPEVAERDFPPISRQELRDAITDVSGRSAPGSDHLRWPYVAALVKHDICGETLRVPPGGTPELPGKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.58
4 0.6
5 0.63
6 0.67
7 0.68
8 0.65
9 0.64
10 0.64
11 0.6
12 0.53
13 0.43
14 0.33
15 0.26
16 0.19
17 0.16
18 0.1
19 0.07
20 0.07
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.1
32 0.1
33 0.13
34 0.14
35 0.15
36 0.14
37 0.14
38 0.13
39 0.12
40 0.16
41 0.18
42 0.18
43 0.16
44 0.17
45 0.17
46 0.19
47 0.19
48 0.18
49 0.16
50 0.2
51 0.25
52 0.27
53 0.27
54 0.3
55 0.3
56 0.29
57 0.29
58 0.32
59 0.32
60 0.4
61 0.46
62 0.51
63 0.61
64 0.69
65 0.71
66 0.69
67 0.65
68 0.59
69 0.55
70 0.47
71 0.38
72 0.28
73 0.28
74 0.27
75 0.26
76 0.26
77 0.24
78 0.25
79 0.31
80 0.38
81 0.42
82 0.48
83 0.59
84 0.65
85 0.72
86 0.78
87 0.8
88 0.83
89 0.85
90 0.85
91 0.85
92 0.83
93 0.84
94 0.83
95 0.83
96 0.78
97 0.73
98 0.67
99 0.6
100 0.55
101 0.44
102 0.37
103 0.29
104 0.25
105 0.2
106 0.17
107 0.18
108 0.17
109 0.2
110 0.2
111 0.22
112 0.23
113 0.24
114 0.23
115 0.2
116 0.22
117 0.22
118 0.27
119 0.26
120 0.26
121 0.26
122 0.24
123 0.24
124 0.21
125 0.19
126 0.15
127 0.15
128 0.18
129 0.18
130 0.18
131 0.2
132 0.19
133 0.19
134 0.19
135 0.17
136 0.14
137 0.13
138 0.12
139 0.1
140 0.08
141 0.07
142 0.06
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.04
151 0.06
152 0.08
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.09
159 0.08
160 0.07
161 0.09
162 0.09
163 0.1
164 0.1
165 0.1
166 0.1
167 0.09
168 0.08
169 0.07
170 0.09
171 0.07
172 0.07
173 0.1
174 0.1
175 0.14
176 0.14
177 0.14
178 0.16
179 0.18
180 0.24
181 0.26
182 0.27
183 0.29
184 0.33
185 0.34
186 0.34
187 0.33
188 0.28
189 0.25
190 0.24
191 0.18
192 0.17
193 0.15
194 0.13
195 0.11
196 0.11
197 0.09
198 0.15
199 0.2
200 0.2
201 0.27
202 0.29
203 0.31
204 0.3
205 0.31
206 0.26
207 0.26
208 0.29
209 0.22
210 0.25
211 0.29
212 0.29
213 0.29
214 0.28
215 0.24
216 0.2
217 0.22
218 0.19
219 0.17
220 0.19
221 0.21
222 0.21
223 0.21
224 0.2
225 0.23
226 0.25
227 0.22
228 0.22
229 0.25