Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2V9M7

Protein Details
Accession A0A1M2V9M7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-68GTVLTKNPKNKKTKKTKKGKDKAGNQASGHydrophilic
NLS Segment(s)
PositionSequence
46-62NPKNKKTKKTKKGKDKA
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences SAPAPGAQPAQSPARAPAVAPAKNYEAAFATLSSSYGFAGTVLTKNPKNKKTKKTKKGKDKAGNQASGEPPVPSAQGSGTSGGKSQPHAPVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.26
5 0.29
6 0.3
7 0.3
8 0.31
9 0.28
10 0.31
11 0.31
12 0.25
13 0.18
14 0.17
15 0.17
16 0.14
17 0.13
18 0.1
19 0.1
20 0.09
21 0.08
22 0.07
23 0.06
24 0.06
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.11
31 0.14
32 0.21
33 0.28
34 0.35
35 0.45
36 0.54
37 0.63
38 0.71
39 0.79
40 0.83
41 0.87
42 0.9
43 0.91
44 0.92
45 0.92
46 0.91
47 0.89
48 0.89
49 0.85
50 0.79
51 0.68
52 0.63
53 0.53
54 0.46
55 0.37
56 0.26
57 0.2
58 0.17
59 0.16
60 0.11
61 0.11
62 0.09
63 0.11
64 0.12
65 0.14
66 0.14
67 0.14
68 0.15
69 0.17
70 0.19
71 0.19
72 0.23