Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W0Q7

Protein Details
Accession A0A1M2W0Q7   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-45ISYGRFQRVRRPPFRYRARAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 8, cyto_nucl 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000424  Primosome_PriB/ssb  
Gene Ontology GO:0003697  F:single-stranded DNA binding  
Pfam View protein in Pfam  
PF00436  SSB  
PROSITE View protein in PROSITE  
PS50935  SSB  
CDD cd04496  SSB_OBF  
Amino Acid Sequences MAKLLLIGRLGKDPEVRYTKTEKEYISYGRFQRVRRPPFRYRARAHVEIGAQPTTTWHHVLSFNPGANNYLRTLKRGSLVFAEANFELRQPDPNADPDSPEGQRQIFLRHESPRPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.36
4 0.36
5 0.42
6 0.46
7 0.46
8 0.48
9 0.4
10 0.37
11 0.39
12 0.41
13 0.39
14 0.39
15 0.36
16 0.4
17 0.44
18 0.43
19 0.49
20 0.53
21 0.58
22 0.61
23 0.67
24 0.66
25 0.72
26 0.8
27 0.79
28 0.73
29 0.73
30 0.72
31 0.67
32 0.6
33 0.53
34 0.44
35 0.37
36 0.35
37 0.26
38 0.18
39 0.15
40 0.14
41 0.13
42 0.13
43 0.11
44 0.09
45 0.11
46 0.12
47 0.13
48 0.18
49 0.18
50 0.17
51 0.17
52 0.17
53 0.17
54 0.16
55 0.17
56 0.12
57 0.17
58 0.17
59 0.19
60 0.21
61 0.21
62 0.24
63 0.23
64 0.23
65 0.19
66 0.21
67 0.2
68 0.18
69 0.19
70 0.15
71 0.17
72 0.15
73 0.13
74 0.13
75 0.12
76 0.16
77 0.15
78 0.19
79 0.18
80 0.23
81 0.27
82 0.26
83 0.28
84 0.27
85 0.3
86 0.28
87 0.29
88 0.27
89 0.23
90 0.26
91 0.25
92 0.27
93 0.27
94 0.31
95 0.35
96 0.39