Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W158

Protein Details
Accession A0A1M2W158   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
150-169SREPMRKIKRMRGRELRLIQBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004625  PyrdxlKinase  
IPR029056  Ribokinase-like  
Gene Ontology GO:0008478  F:pyridoxal kinase activity  
GO:0009443  P:pyridoxal 5'-phosphate salvage  
Amino Acid Sequences MTDPSSLRRAIQTLHDTYHVPHVVISSIPLRPWLTQLLPPHLRPPADSADADYLACIASSRTDTVGTSAVYAKCFPCLPGYFSGVGDLFSALVLAHFDGASSKGAHDESPLSRAASQAVSQTHAILSLTHEASMALPEDERQVTDEELDSREPMRKIKRMRGRELRLIQGQDIIRGTQPIEYRRLEPWTDFWAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.33
5 0.39
6 0.32
7 0.25
8 0.22
9 0.2
10 0.19
11 0.18
12 0.19
13 0.13
14 0.14
15 0.14
16 0.16
17 0.17
18 0.17
19 0.19
20 0.21
21 0.21
22 0.25
23 0.29
24 0.35
25 0.38
26 0.38
27 0.4
28 0.39
29 0.37
30 0.33
31 0.33
32 0.29
33 0.28
34 0.27
35 0.25
36 0.25
37 0.25
38 0.23
39 0.18
40 0.13
41 0.1
42 0.09
43 0.07
44 0.04
45 0.05
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.1
52 0.12
53 0.1
54 0.1
55 0.13
56 0.13
57 0.13
58 0.15
59 0.13
60 0.13
61 0.13
62 0.13
63 0.13
64 0.14
65 0.16
66 0.17
67 0.19
68 0.19
69 0.18
70 0.19
71 0.15
72 0.13
73 0.11
74 0.08
75 0.06
76 0.05
77 0.05
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.07
93 0.08
94 0.1
95 0.09
96 0.11
97 0.12
98 0.11
99 0.11
100 0.11
101 0.12
102 0.1
103 0.1
104 0.11
105 0.11
106 0.13
107 0.13
108 0.13
109 0.11
110 0.11
111 0.1
112 0.07
113 0.09
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.1
120 0.1
121 0.09
122 0.06
123 0.06
124 0.06
125 0.08
126 0.09
127 0.09
128 0.09
129 0.1
130 0.1
131 0.11
132 0.12
133 0.11
134 0.13
135 0.13
136 0.13
137 0.13
138 0.18
139 0.18
140 0.24
141 0.31
142 0.37
143 0.44
144 0.53
145 0.62
146 0.66
147 0.75
148 0.79
149 0.79
150 0.81
151 0.79
152 0.76
153 0.72
154 0.65
155 0.55
156 0.5
157 0.43
158 0.36
159 0.32
160 0.25
161 0.2
162 0.19
163 0.19
164 0.17
165 0.22
166 0.23
167 0.27
168 0.29
169 0.31
170 0.34
171 0.39
172 0.37
173 0.35
174 0.35