Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2W6Y6

Protein Details
Accession A0A1M2W6Y6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86KDDGHRTRSKGKGKRRAPSEBasic
NLS Segment(s)
PositionSequence
72-85RTRSKGKGKRRAPS
Subcellular Location(s) mito 11, extr 7, cyto 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MPPDAYNTSALSNVSCARVPSLSAASSANAPSSISAPTAAFAKALDQSTLTEGAREEWSSGLQTVWKDDGHRTRSKGKGKRRAPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.15
5 0.15
6 0.15
7 0.15
8 0.16
9 0.14
10 0.14
11 0.14
12 0.13
13 0.14
14 0.13
15 0.11
16 0.08
17 0.08
18 0.07
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.07
28 0.06
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.11
37 0.1
38 0.08
39 0.08
40 0.1
41 0.11
42 0.11
43 0.1
44 0.09
45 0.1
46 0.1
47 0.1
48 0.08
49 0.1
50 0.1
51 0.12
52 0.13
53 0.14
54 0.15
55 0.22
56 0.3
57 0.34
58 0.41
59 0.43
60 0.5
61 0.58
62 0.67
63 0.69
64 0.71
65 0.76
66 0.79