Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VNG9

Protein Details
Accession A0A1M2VNG9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-61ALRTRRSRTTRRTFKRSVKKAKEQFYEHydrophilic
NLS Segment(s)
PositionSequence
39-56RRSRTTRRTFKRSVKKAK
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MAAVRRSWDAHAEAPRPSSRAKRWWNQTCTDELEALRTRRSRTTRRTFKRSVKKAKEQFYEERIAAAREKGKRVWDVVSWTNPRALPMYKALVHDGRLLVELDDLWSAVDAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.35
4 0.36
5 0.38
6 0.38
7 0.45
8 0.52
9 0.57
10 0.66
11 0.74
12 0.75
13 0.73
14 0.68
15 0.62
16 0.58
17 0.5
18 0.41
19 0.31
20 0.31
21 0.3
22 0.28
23 0.29
24 0.26
25 0.27
26 0.33
27 0.4
28 0.43
29 0.49
30 0.59
31 0.65
32 0.72
33 0.78
34 0.79
35 0.82
36 0.84
37 0.84
38 0.84
39 0.82
40 0.83
41 0.82
42 0.82
43 0.76
44 0.71
45 0.65
46 0.58
47 0.52
48 0.42
49 0.36
50 0.28
51 0.24
52 0.19
53 0.18
54 0.19
55 0.19
56 0.22
57 0.23
58 0.26
59 0.27
60 0.28
61 0.28
62 0.24
63 0.27
64 0.29
65 0.34
66 0.34
67 0.33
68 0.34
69 0.31
70 0.3
71 0.28
72 0.25
73 0.2
74 0.21
75 0.25
76 0.25
77 0.26
78 0.29
79 0.28
80 0.28
81 0.28
82 0.25
83 0.2
84 0.19
85 0.18
86 0.14
87 0.13
88 0.11
89 0.09
90 0.09
91 0.08
92 0.07