Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YSN0

Protein Details
Accession G8YSN0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-72VDEIRRRIEKRKKRHYYQSRNLNTLHydrophilic
NLS Segment(s)
PositionSequence
52-61RRRIEKRKKR
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MSNSTDESSSKLVKDERKKLVWIDHSVEDFSKDDDSRSNTGDSSSGEVDEIRRRIEKRKKRHYYQSRNLNTLNQHDKRARNTLAARKYRERRQKELDVLDKRVKALENELESAKLEAKWWKMEASRWQAYAKNSEESFSNPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.56
4 0.57
5 0.6
6 0.59
7 0.62
8 0.59
9 0.55
10 0.5
11 0.46
12 0.43
13 0.41
14 0.37
15 0.31
16 0.25
17 0.2
18 0.19
19 0.15
20 0.14
21 0.17
22 0.22
23 0.22
24 0.23
25 0.23
26 0.2
27 0.2
28 0.2
29 0.17
30 0.16
31 0.14
32 0.12
33 0.11
34 0.11
35 0.13
36 0.16
37 0.17
38 0.15
39 0.19
40 0.21
41 0.31
42 0.41
43 0.49
44 0.54
45 0.65
46 0.73
47 0.77
48 0.86
49 0.87
50 0.88
51 0.88
52 0.88
53 0.8
54 0.74
55 0.67
56 0.59
57 0.5
58 0.45
59 0.45
60 0.35
61 0.36
62 0.37
63 0.39
64 0.4
65 0.44
66 0.39
67 0.36
68 0.4
69 0.44
70 0.48
71 0.51
72 0.53
73 0.55
74 0.62
75 0.65
76 0.7
77 0.68
78 0.67
79 0.69
80 0.72
81 0.7
82 0.71
83 0.71
84 0.66
85 0.64
86 0.62
87 0.54
88 0.46
89 0.41
90 0.34
91 0.26
92 0.26
93 0.27
94 0.24
95 0.25
96 0.26
97 0.24
98 0.24
99 0.23
100 0.2
101 0.14
102 0.13
103 0.16
104 0.19
105 0.22
106 0.23
107 0.26
108 0.27
109 0.32
110 0.4
111 0.44
112 0.45
113 0.44
114 0.46
115 0.46
116 0.47
117 0.49
118 0.43
119 0.41
120 0.37
121 0.35
122 0.34