Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2V7K2

Protein Details
Accession A0A1M2V7K2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
221-240SAYISRRRPRRPSALGPTPLHydrophilic
253-283CAFPMARSLKHKRRVPRGRPKMRRVNENRTVHydrophilic
NLS Segment(s)
PositionSequence
260-276SLKHKRRVPRGRPKMRR
Subcellular Location(s) mito 16, cyto 4, nucl 3, plas 3
Family & Domain DBs
Amino Acid Sequences MSCMTYNPALAAASICTVMGVPPRPPSRTSLPPLPTPTQPPPPSYLVSFARVLVRRKRLYSTDSCETSVSLGQATGQIEWNPAWIYGTPQPETSSHVSFAIEDAILRKPTDTAVLPVPQSEAAAGPVMAPRPIKPDSYDFGVPTVTIADPVPAIDDIPEIPDEDIMSSSPPVMLDGRVNPMMWAPSEIEMDRMPPLLPVDTASRTSARRASQAEMDKSLVSAYISRRRPRRPSALGPTPLPTIPEHNEWPSICAFPMARSLKHKRRVPRGRPKMRRVNENRTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.08
6 0.13
7 0.15
8 0.17
9 0.25
10 0.3
11 0.33
12 0.35
13 0.4
14 0.42
15 0.48
16 0.52
17 0.53
18 0.53
19 0.57
20 0.62
21 0.59
22 0.55
23 0.54
24 0.53
25 0.54
26 0.52
27 0.49
28 0.47
29 0.47
30 0.46
31 0.4
32 0.4
33 0.32
34 0.33
35 0.31
36 0.27
37 0.3
38 0.33
39 0.38
40 0.4
41 0.47
42 0.48
43 0.5
44 0.54
45 0.52
46 0.54
47 0.56
48 0.55
49 0.53
50 0.51
51 0.49
52 0.44
53 0.4
54 0.34
55 0.27
56 0.19
57 0.12
58 0.09
59 0.08
60 0.11
61 0.11
62 0.1
63 0.1
64 0.1
65 0.11
66 0.11
67 0.13
68 0.1
69 0.1
70 0.1
71 0.09
72 0.12
73 0.16
74 0.2
75 0.19
76 0.2
77 0.21
78 0.21
79 0.25
80 0.25
81 0.22
82 0.19
83 0.19
84 0.18
85 0.16
86 0.16
87 0.12
88 0.08
89 0.07
90 0.07
91 0.09
92 0.1
93 0.1
94 0.1
95 0.09
96 0.1
97 0.12
98 0.11
99 0.11
100 0.13
101 0.15
102 0.14
103 0.14
104 0.15
105 0.12
106 0.11
107 0.09
108 0.07
109 0.05
110 0.06
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.12
119 0.13
120 0.14
121 0.15
122 0.18
123 0.19
124 0.23
125 0.23
126 0.19
127 0.18
128 0.17
129 0.15
130 0.11
131 0.1
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.04
140 0.05
141 0.04
142 0.04
143 0.04
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.06
160 0.07
161 0.08
162 0.09
163 0.13
164 0.13
165 0.13
166 0.12
167 0.12
168 0.12
169 0.11
170 0.11
171 0.09
172 0.09
173 0.11
174 0.11
175 0.12
176 0.11
177 0.12
178 0.11
179 0.11
180 0.09
181 0.09
182 0.1
183 0.09
184 0.09
185 0.09
186 0.12
187 0.13
188 0.15
189 0.16
190 0.18
191 0.18
192 0.21
193 0.25
194 0.23
195 0.27
196 0.28
197 0.3
198 0.34
199 0.41
200 0.41
201 0.38
202 0.37
203 0.32
204 0.29
205 0.26
206 0.19
207 0.12
208 0.13
209 0.16
210 0.24
211 0.31
212 0.38
213 0.47
214 0.55
215 0.64
216 0.69
217 0.73
218 0.73
219 0.76
220 0.79
221 0.8
222 0.76
223 0.69
224 0.63
225 0.55
226 0.47
227 0.39
228 0.3
229 0.26
230 0.26
231 0.29
232 0.3
233 0.3
234 0.34
235 0.33
236 0.34
237 0.3
238 0.27
239 0.22
240 0.21
241 0.19
242 0.15
243 0.25
244 0.26
245 0.28
246 0.36
247 0.47
248 0.54
249 0.63
250 0.69
251 0.7
252 0.77
253 0.84
254 0.87
255 0.88
256 0.89
257 0.91
258 0.94
259 0.95
260 0.95
261 0.92
262 0.92
263 0.9