Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W4P3

Protein Details
Accession A0A1M2W4P3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-61SSSPYGRTHVWKRRQKKLPNPAVPVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSLCLAFSSSSRSAASSSAAAKAACAAGTLQTRSVSSSPYGRTHVWKRRQKKLPNPAVPVFPQRLVRVDGSTIIHYTTSPRSLIRLTRDTTNNPLWNAARFVGMDEEEDEVTGRMGRFSRRFGELGGEKSDMNWMDQASDENVEPVPPREGKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.16
4 0.16
5 0.17
6 0.18
7 0.17
8 0.16
9 0.16
10 0.14
11 0.11
12 0.1
13 0.08
14 0.11
15 0.14
16 0.15
17 0.16
18 0.16
19 0.16
20 0.19
21 0.19
22 0.17
23 0.16
24 0.2
25 0.22
26 0.24
27 0.27
28 0.26
29 0.33
30 0.42
31 0.49
32 0.55
33 0.61
34 0.66
35 0.73
36 0.81
37 0.83
38 0.84
39 0.85
40 0.85
41 0.84
42 0.83
43 0.74
44 0.68
45 0.6
46 0.54
47 0.45
48 0.36
49 0.31
50 0.25
51 0.25
52 0.24
53 0.22
54 0.18
55 0.17
56 0.16
57 0.15
58 0.14
59 0.12
60 0.1
61 0.09
62 0.08
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.11
69 0.13
70 0.16
71 0.2
72 0.23
73 0.23
74 0.28
75 0.31
76 0.32
77 0.35
78 0.38
79 0.35
80 0.3
81 0.32
82 0.27
83 0.26
84 0.25
85 0.2
86 0.15
87 0.12
88 0.13
89 0.11
90 0.11
91 0.1
92 0.09
93 0.1
94 0.09
95 0.09
96 0.08
97 0.07
98 0.07
99 0.08
100 0.07
101 0.08
102 0.1
103 0.16
104 0.19
105 0.23
106 0.26
107 0.28
108 0.29
109 0.27
110 0.34
111 0.32
112 0.32
113 0.32
114 0.29
115 0.25
116 0.25
117 0.29
118 0.21
119 0.19
120 0.17
121 0.14
122 0.13
123 0.14
124 0.16
125 0.13
126 0.14
127 0.13
128 0.13
129 0.13
130 0.13
131 0.14
132 0.14
133 0.18
134 0.18
135 0.2