Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YEK5

Protein Details
Accession G8YEK5    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-99IRVGTRTDKKQKPQDKIDIVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_nucl 14.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029756  MTH1187/YkoF-like  
IPR002767  Thiamine_BP  
Pfam View protein in Pfam  
PF01910  Thiamine_BP  
Amino Acid Sequences MTVKLNCLADVCLIPIGTAKVSVSDEVAVITRLARDSHLECTLHSAGTTIEGPWDEVMDLIGQMHQILHEKGVVRIQSDIRVGTRTDKKQKPQDKIDIVESKVKQLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.09
5 0.1
6 0.08
7 0.09
8 0.1
9 0.11
10 0.1
11 0.09
12 0.09
13 0.09
14 0.09
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.11
23 0.12
24 0.16
25 0.19
26 0.18
27 0.17
28 0.23
29 0.23
30 0.19
31 0.17
32 0.14
33 0.1
34 0.12
35 0.12
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.06
54 0.06
55 0.07
56 0.09
57 0.09
58 0.1
59 0.14
60 0.14
61 0.13
62 0.16
63 0.16
64 0.17
65 0.18
66 0.18
67 0.16
68 0.17
69 0.17
70 0.23
71 0.31
72 0.37
73 0.46
74 0.53
75 0.61
76 0.7
77 0.78
78 0.79
79 0.8
80 0.81
81 0.78
82 0.74
83 0.74
84 0.7
85 0.64
86 0.63
87 0.54