FuNGI

A0A1M2VMM4

Protein Details

Accession

A0A1M2VMM4

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
468-488	TTRARSQEVKRLVKKCREAGW	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 15, cyto_mito 13.333, mito 10.5, cyto_nucl 8.333

Family & Domain DBs

InterPro	View protein in InterPro IPR005835 NTP_transferase_dom IPR029044 Nucleotide-diphossugar_trans
Gene Ontology	GO:0016779 F:nucleotidyltransferase activity GO:0044271 P:cellular nitrogen compound biosynthetic process
Pfam	View protein in Pfam PF00483 NTP_transferase
CDD	cd02509 GDP-M1P_Guanylyltransferase

Amino Acid Sequences

MSVSASSQPAAQAAGGPPIEYMFKQIMDAVHKSQIEISELRSECHELRQANASLERQVREGIQSNNNRLGTPGFTTPAPGSPQLRAKSPFLTPGAITSLAVPPSLYVPSPLSDHNLTQFPFGVREIPGFWVVIPAGGAGTRLWPLSREGHPKFLLDLTLKGRSLIQATWDRLLPLSSASRTAIVAGPAHVTSIKEQLPDLLAHNLICEPSAKDSMAAIGLAAAVLAVRDPNAIIGSFAADHMISGDDAFLAAVAEAVEVAKKDYLVTIGIAPSHPSTGFGYVRLGEKLAFQDAPNARLVSSFKEKPDARTAAAYIKTGNYRWNAGMFVVKATFLMDLLKEYKPELHEGLQKIALAWDDEVLRAKVLEEVWPGLEKIAIDNAVAEPAAMDRRVAVVPATFGWDDVGDFSSLADLLPAESNQPRILGDSGLVVTEQAAGGIVVPGSGRLVSLLGVDDLVIVDMPDTLLVTTRARSQEVKRLVKKCREAGWKQLM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.17
3	0.16
4	0.16
5	0.16
6	0.18
7	0.15
8	0.18
9	0.14
10	0.15
11	0.15
12	0.17
13	0.2
14	0.23
15	0.27
16	0.26
17	0.31
18	0.3
19	0.3
20	0.31
21	0.29
22	0.27
23	0.25
24	0.25
25	0.27
26	0.28
27	0.28
28	0.28
29	0.3
30	0.27
31	0.32
32	0.35
33	0.27
34	0.29
35	0.36
36	0.36
37	0.36
38	0.39
39	0.35
40	0.35
41	0.39
42	0.37
43	0.31
44	0.3
45	0.27
46	0.27
47	0.31
48	0.3
49	0.35
50	0.41
51	0.45
52	0.51
53	0.51
54	0.46
55	0.42
56	0.38
57	0.31
58	0.27
59	0.24
60	0.19
61	0.18
62	0.21
63	0.21
64	0.22
65	0.23
66	0.24
67	0.24
68	0.27
69	0.35
70	0.34
71	0.39
72	0.39
73	0.39
74	0.38
75	0.38
76	0.39
77	0.33
78	0.33
79	0.27
80	0.25
81	0.26
82	0.22
83	0.21
84	0.16
85	0.17
86	0.15
87	0.15
88	0.13
89	0.1
90	0.11
91	0.12
92	0.11
93	0.1
94	0.11
95	0.12
96	0.14
97	0.15
98	0.18
99	0.19
100	0.19
101	0.21
102	0.23
103	0.22
104	0.22
105	0.23
106	0.19
107	0.19
108	0.18
109	0.17
110	0.14
111	0.15
112	0.15
113	0.15
114	0.15
115	0.13
116	0.12
117	0.11
118	0.11
119	0.09
120	0.08
121	0.06
122	0.05
123	0.05
124	0.06
125	0.04
126	0.06
127	0.06
128	0.07
129	0.07
130	0.08
131	0.11
132	0.16
133	0.22
134	0.3
135	0.32
136	0.38
137	0.39
138	0.38
139	0.37
140	0.32
141	0.29
142	0.21
143	0.22
144	0.2
145	0.23
146	0.22
147	0.21
148	0.21
149	0.19
150	0.2
151	0.16
152	0.18
153	0.2
154	0.22
155	0.23
156	0.23
157	0.22
158	0.2
159	0.2
160	0.15
161	0.11
162	0.12
163	0.11
164	0.12
165	0.12
166	0.12
167	0.12
168	0.13
169	0.12
170	0.1
171	0.1
172	0.09
173	0.1
174	0.09
175	0.09
176	0.09
177	0.08
178	0.08
179	0.13
180	0.13
181	0.12
182	0.12
183	0.13
184	0.14
185	0.14
186	0.14
187	0.11
188	0.11
189	0.1
190	0.11
191	0.1
192	0.08
193	0.08
194	0.07
195	0.06
196	0.09
197	0.1
198	0.1
199	0.1
200	0.1
201	0.1
202	0.09
203	0.08
204	0.05
205	0.04
206	0.04
207	0.03
208	0.03
209	0.02
210	0.02
211	0.02
212	0.02
213	0.02
214	0.02
215	0.02
216	0.02
217	0.03
218	0.04
219	0.04
220	0.04
221	0.04
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.04
229	0.04
230	0.04
231	0.03
232	0.03
233	0.03
234	0.03
235	0.03
236	0.03
237	0.02
238	0.02
239	0.02
240	0.02
241	0.02
242	0.02
243	0.02
244	0.03
245	0.03
246	0.04
247	0.04
248	0.04
249	0.04
250	0.04
251	0.05
252	0.05
253	0.06
254	0.06
255	0.06
256	0.07
257	0.07
258	0.08
259	0.07
260	0.08
261	0.07
262	0.08
263	0.08
264	0.12
265	0.12
266	0.12
267	0.12
268	0.13
269	0.14
270	0.13
271	0.12
272	0.09
273	0.1
274	0.1
275	0.11
276	0.11
277	0.09
278	0.17
279	0.18
280	0.19
281	0.19
282	0.19
283	0.17
284	0.18
285	0.19
286	0.16
287	0.22
288	0.23
289	0.22
290	0.3
291	0.31
292	0.33
293	0.41
294	0.38
295	0.33
296	0.32
297	0.32
298	0.3
299	0.3
300	0.26
301	0.19
302	0.19
303	0.19
304	0.19
305	0.22
306	0.18
307	0.19
308	0.19
309	0.19
310	0.18
311	0.16
312	0.18
313	0.14
314	0.14
315	0.12
316	0.11
317	0.09
318	0.09
319	0.09
320	0.06
321	0.07
322	0.05
323	0.07
324	0.11
325	0.11
326	0.11
327	0.12
328	0.15
329	0.16
330	0.19
331	0.19
332	0.2
333	0.25
334	0.27
335	0.29
336	0.27
337	0.25
338	0.22
339	0.21
340	0.17
341	0.12
342	0.1
343	0.09
344	0.08
345	0.09
346	0.11
347	0.11
348	0.1
349	0.09
350	0.1
351	0.1
352	0.1
353	0.12
354	0.12
355	0.12
356	0.13
357	0.14
358	0.14
359	0.12
360	0.12
361	0.09
362	0.09
363	0.1
364	0.1
365	0.08
366	0.09
367	0.09
368	0.09
369	0.09
370	0.07
371	0.05
372	0.06
373	0.08
374	0.08
375	0.07
376	0.07
377	0.1
378	0.1
379	0.11
380	0.1
381	0.09
382	0.1
383	0.1
384	0.14
385	0.11
386	0.11
387	0.12
388	0.11
389	0.1
390	0.11
391	0.11
392	0.08
393	0.08
394	0.08
395	0.07
396	0.07
397	0.07
398	0.06
399	0.04
400	0.05
401	0.07
402	0.07
403	0.1
404	0.12
405	0.14
406	0.15
407	0.15
408	0.14
409	0.16
410	0.17
411	0.14
412	0.13
413	0.13
414	0.12
415	0.12
416	0.11
417	0.08
418	0.08
419	0.08
420	0.07
421	0.05
422	0.05
423	0.04
424	0.05
425	0.05
426	0.05
427	0.04
428	0.04
429	0.05
430	0.05
431	0.05
432	0.05
433	0.05
434	0.06
435	0.06
436	0.07
437	0.07
438	0.07
439	0.07
440	0.07
441	0.06
442	0.06
443	0.06
444	0.05
445	0.04
446	0.04
447	0.04
448	0.04
449	0.04
450	0.05
451	0.04
452	0.06
453	0.09
454	0.1
455	0.12
456	0.18
457	0.21
458	0.24
459	0.31
460	0.35
461	0.43
462	0.52
463	0.61
464	0.64
465	0.69
466	0.76
467	0.8
468	0.83
469	0.8
470	0.79
471	0.79
472	0.76

A0A1M2VMM4

3D AlphaFold-predicted Structure Viewer