Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VP57

Protein Details
Accession A0A1M2VP57    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-74FSQQHPRDWRQRPAFQKRPRRTQVLGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences HVKGAVIRRLQCPTVVSSHVSTRSVIRDATAIRHRLQDIETSRTGIRSFSQQHPRDWRQRPAFQKRPRRTQVLGLEKESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.24
5 0.27
6 0.28
7 0.27
8 0.24
9 0.23
10 0.24
11 0.22
12 0.2
13 0.16
14 0.16
15 0.16
16 0.22
17 0.25
18 0.24
19 0.24
20 0.26
21 0.26
22 0.24
23 0.24
24 0.24
25 0.22
26 0.24
27 0.23
28 0.22
29 0.22
30 0.22
31 0.21
32 0.16
33 0.13
34 0.15
35 0.2
36 0.26
37 0.37
38 0.39
39 0.45
40 0.54
41 0.6
42 0.64
43 0.66
44 0.68
45 0.66
46 0.72
47 0.76
48 0.78
49 0.81
50 0.81
51 0.85
52 0.85
53 0.87
54 0.86
55 0.83
56 0.76
57 0.75
58 0.76
59 0.75
60 0.71