Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YBK9

Protein Details
Accession G8YBK9    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
122-141GQNKLSSKGRPKGKWKVEPWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 7, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029000  Cyclophilin-like_dom_sf  
IPR002130  Cyclophilin-type_PPIase_dom  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0000413  P:protein peptidyl-prolyl isomerization  
Pfam View protein in Pfam  
PF00160  Pro_isomerase  
PROSITE View protein in PROSITE  
PS50072  CSA_PPIASE_2  
Amino Acid Sequences MRHCAIGTYKNTCILKLILKFILQLGDPTNTGKHSEPADAENPIKVSKKDYKPSSVGESDISRGTVFAVKNPNREDRLGSQFFICLDESYSEALKDTEKYVKLGKVVEGLEAIRVIETELSGQNKLSSKGRPKGKWKVEPWVQDVVIHYNPFAHCSDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.31
4 0.34
5 0.28
6 0.28
7 0.28
8 0.26
9 0.25
10 0.18
11 0.17
12 0.14
13 0.14
14 0.14
15 0.15
16 0.16
17 0.15
18 0.18
19 0.17
20 0.18
21 0.18
22 0.2
23 0.2
24 0.23
25 0.24
26 0.24
27 0.24
28 0.21
29 0.21
30 0.2
31 0.22
32 0.18
33 0.22
34 0.29
35 0.37
36 0.44
37 0.47
38 0.51
39 0.52
40 0.54
41 0.54
42 0.45
43 0.38
44 0.31
45 0.28
46 0.23
47 0.2
48 0.17
49 0.11
50 0.1
51 0.1
52 0.12
53 0.1
54 0.12
55 0.22
56 0.23
57 0.28
58 0.31
59 0.35
60 0.33
61 0.34
62 0.33
63 0.29
64 0.34
65 0.31
66 0.29
67 0.24
68 0.22
69 0.22
70 0.2
71 0.16
72 0.08
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.1
84 0.13
85 0.14
86 0.16
87 0.18
88 0.2
89 0.21
90 0.21
91 0.2
92 0.19
93 0.18
94 0.17
95 0.15
96 0.13
97 0.12
98 0.11
99 0.1
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.06
106 0.09
107 0.11
108 0.11
109 0.12
110 0.15
111 0.17
112 0.2
113 0.22
114 0.27
115 0.35
116 0.43
117 0.52
118 0.57
119 0.65
120 0.73
121 0.79
122 0.81
123 0.77
124 0.79
125 0.78
126 0.76
127 0.71
128 0.67
129 0.57
130 0.49
131 0.46
132 0.42
133 0.37
134 0.31
135 0.26
136 0.24
137 0.24
138 0.25