Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SFW2

Protein Details
Accession A0A1L9SFW2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-61VEVVVQGKSKRGKKKKKKRPRDCPIRTRTKAPBasic
NLS Segment(s)
PositionSequence
37-64KSKRGKKKKKKRPRDCPIRTRTKAPGRR
Subcellular Location(s) mito 6extr 6, cyto 4, plas 4, mito_nucl 4, nucl 2, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLKPAITVDSFNSYVATMLCAVVAIVVLLVEVVVQGKSKRGKKKKKKRPRDCPIRTRTKAPGRRGPLSSLQSSRHCLFVSRPDGFTELFRYGGMECRSTEGAEASETPPGERSTGDCNSPLTVTVGQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.08
5 0.08
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.03
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.03
20 0.03
21 0.05
22 0.05
23 0.11
24 0.19
25 0.26
26 0.37
27 0.47
28 0.59
29 0.69
30 0.8
31 0.87
32 0.91
33 0.95
34 0.95
35 0.96
36 0.96
37 0.96
38 0.95
39 0.94
40 0.92
41 0.91
42 0.83
43 0.76
44 0.74
45 0.73
46 0.71
47 0.67
48 0.66
49 0.61
50 0.62
51 0.59
52 0.53
53 0.49
54 0.45
55 0.41
56 0.35
57 0.33
58 0.31
59 0.34
60 0.31
61 0.27
62 0.23
63 0.21
64 0.21
65 0.25
66 0.29
67 0.27
68 0.27
69 0.26
70 0.27
71 0.27
72 0.26
73 0.21
74 0.16
75 0.14
76 0.13
77 0.13
78 0.12
79 0.18
80 0.19
81 0.16
82 0.16
83 0.19
84 0.2
85 0.19
86 0.19
87 0.14
88 0.13
89 0.13
90 0.14
91 0.11
92 0.14
93 0.14
94 0.14
95 0.15
96 0.15
97 0.15
98 0.13
99 0.15
100 0.19
101 0.22
102 0.24
103 0.23
104 0.24
105 0.25
106 0.25
107 0.23
108 0.2