Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SGR9

Protein Details
Accession A0A1L9SGR9    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
8-31TAQEHDQKKSRGKRTRKMPTKDETBasic
NLS Segment(s)
PositionSequence
15-24KKSRGKRTRK
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MHRSINKTAQEHDQKKSRGKRTRKMPTKDETATLRGTLQEMLSLKLNTRGGKEGKEEEEEEEEEENRTVQYQEPAVDSLQELSVFALKKMSLHPSQPVIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.73
4 0.73
5 0.72
6 0.78
7 0.8
8 0.82
9 0.87
10 0.88
11 0.86
12 0.83
13 0.8
14 0.78
15 0.7
16 0.64
17 0.56
18 0.49
19 0.41
20 0.34
21 0.28
22 0.2
23 0.19
24 0.15
25 0.11
26 0.11
27 0.1
28 0.11
29 0.12
30 0.12
31 0.11
32 0.15
33 0.18
34 0.16
35 0.17
36 0.2
37 0.19
38 0.2
39 0.23
40 0.21
41 0.21
42 0.23
43 0.22
44 0.19
45 0.21
46 0.19
47 0.18
48 0.16
49 0.14
50 0.12
51 0.12
52 0.1
53 0.08
54 0.08
55 0.08
56 0.08
57 0.1
58 0.11
59 0.12
60 0.13
61 0.15
62 0.14
63 0.14
64 0.13
65 0.11
66 0.11
67 0.09
68 0.08
69 0.08
70 0.11
71 0.11
72 0.11
73 0.12
74 0.11
75 0.13
76 0.16
77 0.22
78 0.23
79 0.26
80 0.31