Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9S7I7

Protein Details
Accession A0A1L9S7I7    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
169-193PFAVDKTQTKKKKKDKDKETTTSNTHydrophilic
275-300SSPSGVFPKKKKLNGSKKPIGKKPSLHydrophilic
NLS Segment(s)
PositionSequence
178-183KKKKKD
282-303PKKKKLNGSKKPIGKKPSLPSK
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MGDSNGSTKSLPNGTIAKLTCDILDGTFYNIIHDIVAKVHRDEKIARMRSAVTIARQRGEEEARRLREGTAGKATPAVPAKPGDPEAEAQSFTNIRVETEGAIFDEGKVYLKGNPLKTTKEIICPDCRLPRLLYPVAGIGARPPPDPSREYCQRQPLISKPGHDVHGNPFAVDKTQTKKKKKDKDKETTTSNTPASSPPGTPESGASKEILFPTVKCPNCPRYFGVTRFAMHLDRCMGLSSRGTGRTRTPADSGSATPNPASNPPKRPLVDEDGSSPSGVFPKKKKLNGSKKPIGKKPSLPSKLKNGTTPDMAAAADAEIKSEAVGEDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.33
3 0.32
4 0.31
5 0.29
6 0.29
7 0.24
8 0.22
9 0.21
10 0.15
11 0.17
12 0.13
13 0.14
14 0.17
15 0.16
16 0.16
17 0.16
18 0.16
19 0.13
20 0.14
21 0.11
22 0.12
23 0.16
24 0.17
25 0.18
26 0.23
27 0.25
28 0.28
29 0.29
30 0.35
31 0.41
32 0.45
33 0.44
34 0.41
35 0.41
36 0.39
37 0.42
38 0.36
39 0.32
40 0.34
41 0.36
42 0.36
43 0.35
44 0.34
45 0.34
46 0.37
47 0.37
48 0.38
49 0.44
50 0.45
51 0.46
52 0.46
53 0.42
54 0.41
55 0.37
56 0.34
57 0.33
58 0.29
59 0.28
60 0.29
61 0.29
62 0.28
63 0.28
64 0.24
65 0.19
66 0.19
67 0.2
68 0.21
69 0.22
70 0.19
71 0.17
72 0.18
73 0.2
74 0.2
75 0.2
76 0.17
77 0.17
78 0.16
79 0.15
80 0.17
81 0.13
82 0.12
83 0.12
84 0.13
85 0.11
86 0.11
87 0.11
88 0.08
89 0.09
90 0.09
91 0.08
92 0.08
93 0.07
94 0.08
95 0.08
96 0.08
97 0.1
98 0.16
99 0.21
100 0.23
101 0.29
102 0.3
103 0.33
104 0.35
105 0.38
106 0.33
107 0.36
108 0.37
109 0.35
110 0.38
111 0.37
112 0.39
113 0.39
114 0.38
115 0.33
116 0.3
117 0.3
118 0.32
119 0.3
120 0.26
121 0.21
122 0.21
123 0.19
124 0.17
125 0.13
126 0.08
127 0.11
128 0.11
129 0.11
130 0.13
131 0.13
132 0.17
133 0.19
134 0.21
135 0.26
136 0.33
137 0.38
138 0.41
139 0.47
140 0.46
141 0.45
142 0.46
143 0.42
144 0.41
145 0.37
146 0.34
147 0.3
148 0.31
149 0.31
150 0.28
151 0.24
152 0.21
153 0.27
154 0.25
155 0.21
156 0.19
157 0.18
158 0.18
159 0.18
160 0.17
161 0.15
162 0.25
163 0.34
164 0.42
165 0.52
166 0.61
167 0.7
168 0.79
169 0.84
170 0.85
171 0.87
172 0.88
173 0.85
174 0.8
175 0.74
176 0.67
177 0.61
178 0.5
179 0.4
180 0.31
181 0.26
182 0.24
183 0.21
184 0.17
185 0.15
186 0.17
187 0.17
188 0.16
189 0.17
190 0.17
191 0.17
192 0.18
193 0.16
194 0.14
195 0.15
196 0.15
197 0.16
198 0.12
199 0.11
200 0.16
201 0.24
202 0.24
203 0.26
204 0.31
205 0.38
206 0.41
207 0.44
208 0.42
209 0.42
210 0.48
211 0.48
212 0.48
213 0.42
214 0.39
215 0.37
216 0.35
217 0.29
218 0.23
219 0.22
220 0.18
221 0.16
222 0.16
223 0.15
224 0.14
225 0.13
226 0.14
227 0.14
228 0.16
229 0.21
230 0.22
231 0.23
232 0.26
233 0.33
234 0.35
235 0.35
236 0.34
237 0.3
238 0.32
239 0.32
240 0.3
241 0.29
242 0.27
243 0.25
244 0.23
245 0.23
246 0.21
247 0.26
248 0.31
249 0.31
250 0.37
251 0.4
252 0.48
253 0.47
254 0.5
255 0.49
256 0.51
257 0.47
258 0.42
259 0.42
260 0.38
261 0.38
262 0.33
263 0.27
264 0.19
265 0.21
266 0.23
267 0.26
268 0.27
269 0.38
270 0.47
271 0.53
272 0.63
273 0.69
274 0.76
275 0.8
276 0.85
277 0.84
278 0.85
279 0.88
280 0.86
281 0.83
282 0.79
283 0.77
284 0.77
285 0.78
286 0.79
287 0.76
288 0.73
289 0.77
290 0.78
291 0.73
292 0.69
293 0.65
294 0.6
295 0.57
296 0.52
297 0.42
298 0.34
299 0.3
300 0.24
301 0.17
302 0.13
303 0.12
304 0.1
305 0.1
306 0.1
307 0.1
308 0.09
309 0.1