Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SJJ9

Protein Details
Accession A0A1L9SJJ9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41KIPWRLSAPQKARQRKRLRSVDKVIDTHydrophilic
73-102DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-94KEKKYRKGIHKLPK
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLLSGLLWKIPWRLSAPQKARQRKRLRSVDKVIDTVTAALYKKGFTAKAVEQWNHEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.21
5 0.23
6 0.29
7 0.34
8 0.44
9 0.49
10 0.55
11 0.64
12 0.72
13 0.77
14 0.8
15 0.82
16 0.82
17 0.86
18 0.87
19 0.85
20 0.84
21 0.83
22 0.81
23 0.73
24 0.64
25 0.54
26 0.44
27 0.36
28 0.27
29 0.19
30 0.12
31 0.09
32 0.09
33 0.09
34 0.08
35 0.09
36 0.1
37 0.1
38 0.09
39 0.13
40 0.13
41 0.19
42 0.23
43 0.23
44 0.23
45 0.27
46 0.3
47 0.27
48 0.27
49 0.22
50 0.19
51 0.22
52 0.22
53 0.18
54 0.18
55 0.2
56 0.25
57 0.24
58 0.23
59 0.22
60 0.2
61 0.23
62 0.26
63 0.32
64 0.3
65 0.39
66 0.45
67 0.53
68 0.63
69 0.68
70 0.71
71 0.72
72 0.79
73 0.8
74 0.85
75 0.85
76 0.86
77 0.86
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79