Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SRE6

Protein Details
Accession A0A1L9SRE6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-125KHESSLKTEKAKKKQIHFPQRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
87-119PKLTRELRRKLTKHESSLKTEKAKKKQIHFPQR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSKVKAGQLWGKSKDELSTQLEELKTELSQLRVQKMASGGSSKSQRIHDVRKSIARVLTVIHANQRAQLRLFYKNKKYLPLDLRPKLTRELRRKLTKHESSLKTEKAKKKQIHFPQRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.41
4 0.36
5 0.34
6 0.3
7 0.29
8 0.26
9 0.29
10 0.28
11 0.26
12 0.24
13 0.2
14 0.15
15 0.14
16 0.15
17 0.13
18 0.17
19 0.2
20 0.22
21 0.23
22 0.23
23 0.22
24 0.22
25 0.21
26 0.18
27 0.17
28 0.14
29 0.18
30 0.21
31 0.21
32 0.23
33 0.23
34 0.28
35 0.31
36 0.39
37 0.39
38 0.41
39 0.43
40 0.44
41 0.45
42 0.41
43 0.37
44 0.29
45 0.23
46 0.19
47 0.18
48 0.15
49 0.13
50 0.13
51 0.13
52 0.13
53 0.17
54 0.17
55 0.16
56 0.15
57 0.18
58 0.19
59 0.26
60 0.33
61 0.37
62 0.43
63 0.5
64 0.51
65 0.55
66 0.55
67 0.55
68 0.55
69 0.57
70 0.6
71 0.56
72 0.61
73 0.56
74 0.55
75 0.54
76 0.55
77 0.55
78 0.54
79 0.6
80 0.63
81 0.71
82 0.72
83 0.75
84 0.77
85 0.75
86 0.74
87 0.74
88 0.7
89 0.68
90 0.73
91 0.7
92 0.69
93 0.7
94 0.71
95 0.71
96 0.76
97 0.76
98 0.77
99 0.8
100 0.83
101 0.85
102 0.86
103 0.85
104 0.86
105 0.88