Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SV31

Protein Details
Accession A0A1L9SV31    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
143-167GPSDVPAARKPKQKKKKIKLSFDDEHydrophilic
NLS Segment(s)
PositionSequence
150-161ARKPKQKKKKIK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKGKNLSYESNEPAFIRRLKSQFGSNDGRLERPAARPRLAMNKNDDDDEPTYVDEATNEVITKEEYEMMVQGSSKTEDQDKSKDQADQTRPEDAADKDSATGANKDTSTTHKQAMADIGGPKKRKQAKVIQEDNLKDTEQGPSDVPAARKPKQKKKKIKLSFDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.34
4 0.32
5 0.3
6 0.33
7 0.34
8 0.37
9 0.39
10 0.43
11 0.42
12 0.45
13 0.48
14 0.43
15 0.46
16 0.43
17 0.41
18 0.35
19 0.34
20 0.3
21 0.31
22 0.38
23 0.36
24 0.37
25 0.37
26 0.39
27 0.47
28 0.48
29 0.45
30 0.44
31 0.45
32 0.45
33 0.45
34 0.42
35 0.35
36 0.32
37 0.29
38 0.22
39 0.16
40 0.15
41 0.13
42 0.13
43 0.08
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.08
65 0.1
66 0.13
67 0.15
68 0.2
69 0.21
70 0.22
71 0.24
72 0.25
73 0.24
74 0.3
75 0.32
76 0.34
77 0.33
78 0.33
79 0.32
80 0.3
81 0.32
82 0.24
83 0.23
84 0.17
85 0.15
86 0.13
87 0.13
88 0.13
89 0.11
90 0.12
91 0.09
92 0.11
93 0.11
94 0.11
95 0.12
96 0.18
97 0.23
98 0.25
99 0.25
100 0.26
101 0.26
102 0.27
103 0.28
104 0.23
105 0.19
106 0.2
107 0.24
108 0.26
109 0.28
110 0.29
111 0.36
112 0.43
113 0.46
114 0.49
115 0.54
116 0.59
117 0.68
118 0.73
119 0.72
120 0.71
121 0.67
122 0.62
123 0.54
124 0.44
125 0.34
126 0.27
127 0.24
128 0.18
129 0.18
130 0.16
131 0.16
132 0.18
133 0.21
134 0.22
135 0.25
136 0.31
137 0.36
138 0.44
139 0.53
140 0.62
141 0.7
142 0.79
143 0.83
144 0.87
145 0.92
146 0.94
147 0.94