Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9S973

Protein Details
Accession A0A1L9S973    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRQPQGPKKREPLATBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRQPQGPKKR
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRQPQGPKKREPLATTFSCLFCNHENSIIVKLDKKLGLGNLSCKVCGQRFQTGINYLSAPVDVYSDWVDACDAVAKDTANYYGTHDTKGARLQNASTSPDPPREHDERLGEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.85
4 0.8
5 0.73
6 0.68
7 0.64
8 0.58
9 0.53
10 0.47
11 0.4
12 0.36
13 0.32
14 0.29
15 0.24
16 0.26
17 0.23
18 0.23
19 0.23
20 0.23
21 0.26
22 0.24
23 0.22
24 0.2
25 0.2
26 0.2
27 0.19
28 0.19
29 0.17
30 0.16
31 0.19
32 0.18
33 0.2
34 0.22
35 0.22
36 0.22
37 0.2
38 0.21
39 0.19
40 0.23
41 0.23
42 0.23
43 0.24
44 0.26
45 0.28
46 0.28
47 0.28
48 0.23
49 0.2
50 0.14
51 0.13
52 0.11
53 0.08
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.06
65 0.08
66 0.07
67 0.07
68 0.09
69 0.08
70 0.09
71 0.1
72 0.11
73 0.09
74 0.09
75 0.12
76 0.19
77 0.19
78 0.2
79 0.21
80 0.21
81 0.23
82 0.29
83 0.29
84 0.25
85 0.25
86 0.26
87 0.3
88 0.33
89 0.36
90 0.31
91 0.31
92 0.32
93 0.39
94 0.4
95 0.37
96 0.42
97 0.42
98 0.45
99 0.48
100 0.49