Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SWH7

Protein Details
Accession A0A1L9SWH7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
39-62HQRYHWIRRHTGRMNIRNRNKASYHydrophilic
139-166RGCVGRELSKHRRKKRDHRSGDIDERDRBasic
NLS Segment(s)
PositionSequence
148-156KHRRKKRDH
Subcellular Location(s) plas 5, cyto 4, E.R. 4, mito 3, extr 3, pero 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR025700  Lys/Orn_oxygenase  
Gene Ontology GO:0044249  P:cellular biosynthetic process  
GO:1901566  P:organonitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF13434  Lys_Orn_oxgnase  
Amino Acid Sequences MEYPDIHSVVIIGAGPCGLAVAARLREETPSALFTDEEHQRYHWIRRHTGRMNIRNRNKASYSVRTDSGAARSKGTGTGTLVLDSTGTSWMQRWKTAFATLEIAQLRSPMFFHIDPADRDGMLAYTRETGREEDLWEIRGCVGRELSKHRRKKRDHRSGDIDERDRKDYYSPSTSLFDAYCSSIVRRYSLDSPGQILHAEVSDITYSLHPELDEEKELFCITGSTGETFYARSVVLAVGAGTGGAKIFPFPLSEQERKAACHSLEITSFPPAGLRGKISRREETTILVVGGGLSSAQIVDMAIKKGVSRVHLLIRGDLKVKHFDIGLTWMGKFKNFEKAAFWSADSDEERLEMFHTARDGGSINPRYVKILKQYVASGKLVIHTHTAIADHRFCPVTNTWEITTNPPTTPALPPAIDYIYFATGVRSDITALPFLQSMLESYPIPTCGGFPCLTDDLMWREDVPLFVTGRFAALRLGPGGPNLEGARLGAERIAWKMQDIRGDTSDQEADDSFRGYSDCFCGLGNRYAGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.05
6 0.03
7 0.05
8 0.11
9 0.13
10 0.15
11 0.17
12 0.17
13 0.2
14 0.22
15 0.23
16 0.19
17 0.19
18 0.19
19 0.18
20 0.17
21 0.17
22 0.23
23 0.27
24 0.26
25 0.26
26 0.26
27 0.32
28 0.37
29 0.44
30 0.44
31 0.45
32 0.52
33 0.59
34 0.68
35 0.69
36 0.74
37 0.75
38 0.79
39 0.82
40 0.83
41 0.84
42 0.84
43 0.81
44 0.78
45 0.7
46 0.68
47 0.66
48 0.64
49 0.63
50 0.57
51 0.55
52 0.49
53 0.49
54 0.43
55 0.43
56 0.42
57 0.34
58 0.32
59 0.31
60 0.31
61 0.32
62 0.3
63 0.25
64 0.19
65 0.22
66 0.21
67 0.2
68 0.19
69 0.16
70 0.15
71 0.12
72 0.11
73 0.08
74 0.07
75 0.07
76 0.1
77 0.18
78 0.2
79 0.24
80 0.25
81 0.28
82 0.3
83 0.34
84 0.33
85 0.28
86 0.3
87 0.27
88 0.3
89 0.27
90 0.26
91 0.2
92 0.2
93 0.18
94 0.14
95 0.14
96 0.1
97 0.14
98 0.13
99 0.15
100 0.19
101 0.23
102 0.24
103 0.27
104 0.27
105 0.22
106 0.22
107 0.2
108 0.16
109 0.12
110 0.12
111 0.09
112 0.11
113 0.12
114 0.13
115 0.14
116 0.15
117 0.17
118 0.18
119 0.19
120 0.19
121 0.21
122 0.22
123 0.2
124 0.19
125 0.17
126 0.2
127 0.19
128 0.16
129 0.17
130 0.17
131 0.21
132 0.3
133 0.4
134 0.46
135 0.55
136 0.63
137 0.72
138 0.79
139 0.87
140 0.89
141 0.89
142 0.89
143 0.88
144 0.87
145 0.85
146 0.84
147 0.8
148 0.75
149 0.71
150 0.65
151 0.59
152 0.5
153 0.43
154 0.36
155 0.33
156 0.32
157 0.31
158 0.29
159 0.28
160 0.29
161 0.29
162 0.27
163 0.23
164 0.18
165 0.14
166 0.14
167 0.12
168 0.11
169 0.11
170 0.14
171 0.14
172 0.15
173 0.15
174 0.17
175 0.19
176 0.23
177 0.25
178 0.21
179 0.23
180 0.22
181 0.22
182 0.18
183 0.15
184 0.11
185 0.08
186 0.08
187 0.05
188 0.06
189 0.05
190 0.05
191 0.06
192 0.05
193 0.06
194 0.07
195 0.07
196 0.06
197 0.07
198 0.09
199 0.11
200 0.12
201 0.12
202 0.11
203 0.11
204 0.12
205 0.1
206 0.08
207 0.07
208 0.05
209 0.07
210 0.08
211 0.08
212 0.08
213 0.09
214 0.09
215 0.09
216 0.09
217 0.07
218 0.07
219 0.06
220 0.06
221 0.05
222 0.05
223 0.05
224 0.05
225 0.04
226 0.03
227 0.03
228 0.03
229 0.03
230 0.02
231 0.02
232 0.02
233 0.03
234 0.03
235 0.04
236 0.05
237 0.06
238 0.12
239 0.18
240 0.21
241 0.22
242 0.26
243 0.26
244 0.26
245 0.28
246 0.25
247 0.19
248 0.19
249 0.19
250 0.17
251 0.16
252 0.17
253 0.15
254 0.13
255 0.13
256 0.1
257 0.09
258 0.09
259 0.1
260 0.09
261 0.1
262 0.14
263 0.19
264 0.27
265 0.31
266 0.33
267 0.35
268 0.38
269 0.37
270 0.33
271 0.3
272 0.23
273 0.19
274 0.15
275 0.11
276 0.08
277 0.07
278 0.05
279 0.03
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.04
287 0.06
288 0.06
289 0.07
290 0.07
291 0.07
292 0.1
293 0.12
294 0.12
295 0.13
296 0.15
297 0.19
298 0.23
299 0.23
300 0.23
301 0.24
302 0.23
303 0.23
304 0.22
305 0.21
306 0.21
307 0.21
308 0.19
309 0.17
310 0.16
311 0.14
312 0.16
313 0.16
314 0.13
315 0.13
316 0.15
317 0.15
318 0.16
319 0.17
320 0.15
321 0.23
322 0.23
323 0.23
324 0.24
325 0.28
326 0.3
327 0.28
328 0.27
329 0.19
330 0.18
331 0.21
332 0.19
333 0.15
334 0.12
335 0.12
336 0.11
337 0.1
338 0.1
339 0.09
340 0.08
341 0.08
342 0.09
343 0.09
344 0.09
345 0.1
346 0.1
347 0.1
348 0.18
349 0.19
350 0.2
351 0.22
352 0.22
353 0.25
354 0.26
355 0.28
356 0.27
357 0.32
358 0.32
359 0.31
360 0.34
361 0.35
362 0.37
363 0.34
364 0.27
365 0.21
366 0.23
367 0.22
368 0.19
369 0.17
370 0.14
371 0.14
372 0.13
373 0.14
374 0.12
375 0.16
376 0.18
377 0.16
378 0.19
379 0.19
380 0.19
381 0.22
382 0.22
383 0.24
384 0.23
385 0.26
386 0.24
387 0.28
388 0.29
389 0.3
390 0.33
391 0.29
392 0.27
393 0.26
394 0.26
395 0.24
396 0.25
397 0.24
398 0.22
399 0.2
400 0.21
401 0.21
402 0.21
403 0.18
404 0.17
405 0.16
406 0.13
407 0.13
408 0.12
409 0.11
410 0.1
411 0.11
412 0.11
413 0.09
414 0.1
415 0.11
416 0.13
417 0.14
418 0.13
419 0.13
420 0.13
421 0.13
422 0.11
423 0.09
424 0.09
425 0.09
426 0.1
427 0.1
428 0.11
429 0.12
430 0.13
431 0.13
432 0.12
433 0.12
434 0.12
435 0.16
436 0.15
437 0.14
438 0.18
439 0.19
440 0.2
441 0.19
442 0.2
443 0.2
444 0.21
445 0.21
446 0.16
447 0.16
448 0.17
449 0.17
450 0.16
451 0.15
452 0.14
453 0.14
454 0.15
455 0.13
456 0.14
457 0.14
458 0.12
459 0.11
460 0.11
461 0.13
462 0.13
463 0.15
464 0.13
465 0.15
466 0.17
467 0.15
468 0.17
469 0.16
470 0.15
471 0.13
472 0.13
473 0.15
474 0.13
475 0.13
476 0.1
477 0.11
478 0.12
479 0.16
480 0.19
481 0.16
482 0.18
483 0.23
484 0.26
485 0.31
486 0.33
487 0.35
488 0.34
489 0.36
490 0.34
491 0.33
492 0.32
493 0.25
494 0.23
495 0.19
496 0.19
497 0.17
498 0.18
499 0.14
500 0.13
501 0.13
502 0.13
503 0.14
504 0.16
505 0.16
506 0.15
507 0.16
508 0.19
509 0.23
510 0.29
511 0.28