Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SE44

Protein Details
Accession A0A1L9SE44    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-26VGERERERERERERKRGRKLLEGSBasic
NLS Segment(s)
PositionSequence
8-22RERERERERKRGRKL
Subcellular Location(s) mito 12, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MNVGERERERERERERKRGRKLLEGSGREGERFRQDLAVIYLSEKAGAVLGCSTPYLPRYSLMTSPVQPLSFPSELSCPDWGDQWGAKKWGSWKAPADYRLTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.81
4 0.86
5 0.86
6 0.81
7 0.8
8 0.77
9 0.76
10 0.75
11 0.67
12 0.61
13 0.57
14 0.53
15 0.44
16 0.39
17 0.32
18 0.27
19 0.26
20 0.22
21 0.18
22 0.18
23 0.19
24 0.2
25 0.19
26 0.13
27 0.13
28 0.13
29 0.11
30 0.11
31 0.09
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.08
44 0.08
45 0.09
46 0.12
47 0.14
48 0.15
49 0.17
50 0.19
51 0.19
52 0.21
53 0.22
54 0.19
55 0.17
56 0.17
57 0.2
58 0.18
59 0.17
60 0.15
61 0.16
62 0.18
63 0.21
64 0.21
65 0.16
66 0.16
67 0.17
68 0.17
69 0.18
70 0.18
71 0.22
72 0.24
73 0.26
74 0.26
75 0.27
76 0.32
77 0.38
78 0.39
79 0.4
80 0.42
81 0.47
82 0.54
83 0.55