Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SAE9

Protein Details
Accession A0A1L9SAE9   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
112-139LYSVFRSRDTRNNRRKEKPGERKTYYDPHydrophilic
NLS Segment(s)
PositionSequence
125-129RRKEK
Subcellular Location(s) cyto_nucl 10.833, nucl 10, cyto 9.5, cyto_pero 6.666, mito 4
Family & Domain DBs
Amino Acid Sequences MAVGPRVSKEEFMRALGLDVRNPQHEQYYKAMRDEAIAVYNRLNNDVSSLIDSVRMDGNTRPPFFWHHVRADKQRWAILEVWRAADPSIRGLFDAGATEGEYGPNWVSGWLLYSVFRSRDTRNNRRKEKPGERKTYYDPVRNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.25
5 0.2
6 0.23
7 0.24
8 0.26
9 0.28
10 0.27
11 0.3
12 0.31
13 0.33
14 0.35
15 0.41
16 0.4
17 0.4
18 0.4
19 0.32
20 0.31
21 0.29
22 0.23
23 0.18
24 0.17
25 0.16
26 0.16
27 0.18
28 0.17
29 0.17
30 0.16
31 0.12
32 0.12
33 0.12
34 0.11
35 0.11
36 0.11
37 0.09
38 0.11
39 0.1
40 0.1
41 0.11
42 0.1
43 0.1
44 0.11
45 0.19
46 0.23
47 0.24
48 0.23
49 0.23
50 0.28
51 0.31
52 0.36
53 0.32
54 0.33
55 0.38
56 0.43
57 0.49
58 0.49
59 0.5
60 0.45
61 0.42
62 0.36
63 0.32
64 0.3
65 0.27
66 0.26
67 0.22
68 0.22
69 0.2
70 0.2
71 0.17
72 0.16
73 0.13
74 0.12
75 0.12
76 0.11
77 0.11
78 0.11
79 0.11
80 0.1
81 0.1
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.06
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.08
97 0.08
98 0.08
99 0.08
100 0.11
101 0.15
102 0.16
103 0.19
104 0.21
105 0.24
106 0.33
107 0.43
108 0.52
109 0.59
110 0.68
111 0.74
112 0.8
113 0.86
114 0.87
115 0.88
116 0.89
117 0.89
118 0.89
119 0.85
120 0.82
121 0.8
122 0.79
123 0.76