Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BBT5

Protein Details
Accession G8BBT5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
90-116FDAYKECRKDFFRKKRQDKIDGKPGWGBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033108  P:mitochondrial respiratory chain complex assembly  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSNASTPQDNKAEQKSTGETDKGKPNVNFTEGGVENYKFYPDDPKNHRHKYKWAAKEASKFYDPCEESRQASMDCLYRNQDDKYVCQDFFDAYKECRKDFFRKKRQDKIDGKPGWGWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.38
4 0.39
5 0.38
6 0.34
7 0.35
8 0.43
9 0.42
10 0.45
11 0.42
12 0.43
13 0.43
14 0.42
15 0.38
16 0.29
17 0.32
18 0.26
19 0.27
20 0.24
21 0.2
22 0.19
23 0.18
24 0.19
25 0.12
26 0.12
27 0.19
28 0.2
29 0.29
30 0.34
31 0.43
32 0.52
33 0.61
34 0.67
35 0.61
36 0.66
37 0.68
38 0.71
39 0.69
40 0.67
41 0.64
42 0.62
43 0.66
44 0.6
45 0.54
46 0.46
47 0.39
48 0.32
49 0.34
50 0.31
51 0.27
52 0.29
53 0.27
54 0.26
55 0.27
56 0.28
57 0.2
58 0.2
59 0.18
60 0.16
61 0.15
62 0.15
63 0.17
64 0.18
65 0.2
66 0.21
67 0.24
68 0.23
69 0.24
70 0.3
71 0.31
72 0.28
73 0.26
74 0.26
75 0.22
76 0.22
77 0.23
78 0.18
79 0.17
80 0.25
81 0.27
82 0.27
83 0.31
84 0.35
85 0.42
86 0.51
87 0.6
88 0.63
89 0.73
90 0.82
91 0.87
92 0.91
93 0.91
94 0.9
95 0.88
96 0.88
97 0.8
98 0.74