Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9S9H6

Protein Details
Accession A0A1L9S9H6   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
131-153IEIMRRVKRAERRRAEQPHRMVEBasic
NLS Segment(s)
PositionSequence
137-144VKRAERRR
Subcellular Location(s) cysk 18, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038882  Rcf3  
Amino Acid Sequences MPPPSSQKGDIEPPPELMTEAVTGFLAGALKFGSVSILAHMILSLPHPFVFSKPASPPTSATHPAPQPSPLSRASLQSRLFYRPLEGFSEWLSPTSRVYRGLTPQFKVFLQIAAMTLGGCLWAEHRVNQYIEIMRRVKRAERRRAEQPHRMVEMEKAREGGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.28
4 0.21
5 0.16
6 0.13
7 0.12
8 0.1
9 0.08
10 0.08
11 0.07
12 0.07
13 0.07
14 0.05
15 0.06
16 0.05
17 0.05
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.08
35 0.09
36 0.1
37 0.14
38 0.14
39 0.16
40 0.19
41 0.25
42 0.26
43 0.27
44 0.29
45 0.28
46 0.33
47 0.32
48 0.31
49 0.3
50 0.3
51 0.3
52 0.29
53 0.27
54 0.23
55 0.22
56 0.24
57 0.2
58 0.22
59 0.21
60 0.25
61 0.26
62 0.3
63 0.29
64 0.29
65 0.3
66 0.29
67 0.29
68 0.24
69 0.23
70 0.17
71 0.18
72 0.18
73 0.16
74 0.14
75 0.14
76 0.16
77 0.14
78 0.14
79 0.14
80 0.11
81 0.12
82 0.15
83 0.15
84 0.15
85 0.17
86 0.19
87 0.24
88 0.33
89 0.35
90 0.34
91 0.35
92 0.34
93 0.32
94 0.31
95 0.25
96 0.17
97 0.14
98 0.12
99 0.11
100 0.1
101 0.1
102 0.07
103 0.06
104 0.05
105 0.04
106 0.04
107 0.03
108 0.04
109 0.09
110 0.1
111 0.13
112 0.16
113 0.2
114 0.21
115 0.22
116 0.25
117 0.26
118 0.28
119 0.32
120 0.32
121 0.31
122 0.36
123 0.38
124 0.42
125 0.47
126 0.55
127 0.6
128 0.65
129 0.69
130 0.75
131 0.83
132 0.84
133 0.83
134 0.81
135 0.79
136 0.73
137 0.67
138 0.58
139 0.55
140 0.55
141 0.5
142 0.43
143 0.36