Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SJ09

Protein Details
Accession A0A1L9SJ09    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
267-298RKDRDGPGKSRNRSKPSKKQKKGSWSWFLFKTHydrophilic
NLS Segment(s)
PositionSequence
265-289KARKDRDGPGKSRNRSKPSKKQKKG
Subcellular Location(s) extr 15, E.R. 3, golg 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR005052  Lectin_leg  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03388  Lectin_leg-like  
PROSITE View protein in PROSITE  
PS51328  L_LECTIN_LIKE  
CDD cd07308  lectin_leg-like  
Amino Acid Sequences MWFPRLSSLLCLAGLAANAVNAYDGDEDIKSIPLRTHSLEPPYLDSDFQSRWFDFGGDTIIRADQYIRLTSDRPSQQGWIFSRVPLTATNWEIELEFKFHGSGNLHGDGFALWLTKQRATPGPVFGSTDRFEGLGIFFDTYKNNRPGTSFPYVMAMMGDGQTTYDQAHDGKDNELAGCSARGLRTSSVPTKARLTYFQDKSLTLDLQYKTEDSWVNCFTLTAPETNIAIPSVAYLGLSAETGEVTDNHDIISLKAQNLYSVSNSKARKDRDGPGKSRNRSKPSKKQKKGSWSWFLFKTVLFFLAVAGAYVGYTTYRAKQRYSRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.08
4 0.06
5 0.06
6 0.06
7 0.06
8 0.05
9 0.07
10 0.07
11 0.07
12 0.09
13 0.09
14 0.1
15 0.1
16 0.14
17 0.13
18 0.13
19 0.15
20 0.17
21 0.21
22 0.24
23 0.29
24 0.31
25 0.37
26 0.39
27 0.38
28 0.39
29 0.38
30 0.35
31 0.3
32 0.26
33 0.25
34 0.23
35 0.25
36 0.25
37 0.22
38 0.22
39 0.22
40 0.21
41 0.17
42 0.16
43 0.17
44 0.13
45 0.13
46 0.13
47 0.13
48 0.12
49 0.12
50 0.12
51 0.11
52 0.13
53 0.15
54 0.16
55 0.18
56 0.19
57 0.22
58 0.29
59 0.3
60 0.3
61 0.29
62 0.31
63 0.32
64 0.38
65 0.38
66 0.35
67 0.32
68 0.3
69 0.31
70 0.27
71 0.26
72 0.2
73 0.2
74 0.18
75 0.19
76 0.18
77 0.17
78 0.17
79 0.16
80 0.16
81 0.13
82 0.11
83 0.1
84 0.09
85 0.1
86 0.1
87 0.12
88 0.13
89 0.15
90 0.17
91 0.18
92 0.18
93 0.17
94 0.17
95 0.14
96 0.13
97 0.1
98 0.07
99 0.05
100 0.09
101 0.11
102 0.13
103 0.14
104 0.17
105 0.21
106 0.24
107 0.26
108 0.26
109 0.26
110 0.24
111 0.26
112 0.24
113 0.24
114 0.21
115 0.19
116 0.16
117 0.13
118 0.13
119 0.11
120 0.1
121 0.08
122 0.07
123 0.07
124 0.07
125 0.08
126 0.09
127 0.11
128 0.17
129 0.2
130 0.2
131 0.2
132 0.22
133 0.24
134 0.29
135 0.31
136 0.25
137 0.21
138 0.23
139 0.22
140 0.2
141 0.17
142 0.11
143 0.07
144 0.06
145 0.06
146 0.03
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.06
155 0.08
156 0.09
157 0.09
158 0.1
159 0.1
160 0.1
161 0.1
162 0.09
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.07
169 0.08
170 0.09
171 0.11
172 0.16
173 0.19
174 0.24
175 0.26
176 0.27
177 0.29
178 0.3
179 0.3
180 0.29
181 0.34
182 0.36
183 0.37
184 0.4
185 0.38
186 0.36
187 0.37
188 0.35
189 0.28
190 0.19
191 0.23
192 0.19
193 0.19
194 0.2
195 0.18
196 0.15
197 0.18
198 0.2
199 0.14
200 0.19
201 0.19
202 0.19
203 0.18
204 0.18
205 0.15
206 0.17
207 0.17
208 0.12
209 0.12
210 0.13
211 0.13
212 0.13
213 0.13
214 0.09
215 0.08
216 0.07
217 0.06
218 0.06
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.05
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.08
232 0.09
233 0.09
234 0.09
235 0.11
236 0.11
237 0.11
238 0.17
239 0.16
240 0.16
241 0.19
242 0.19
243 0.18
244 0.19
245 0.2
246 0.17
247 0.18
248 0.2
249 0.25
250 0.27
251 0.32
252 0.38
253 0.41
254 0.46
255 0.49
256 0.56
257 0.59
258 0.67
259 0.67
260 0.7
261 0.76
262 0.75
263 0.8
264 0.8
265 0.78
266 0.8
267 0.85
268 0.85
269 0.87
270 0.91
271 0.9
272 0.91
273 0.91
274 0.92
275 0.92
276 0.91
277 0.9
278 0.85
279 0.81
280 0.74
281 0.68
282 0.58
283 0.47
284 0.41
285 0.31
286 0.26
287 0.2
288 0.16
289 0.13
290 0.14
291 0.13
292 0.1
293 0.08
294 0.07
295 0.06
296 0.06
297 0.06
298 0.04
299 0.07
300 0.09
301 0.16
302 0.24
303 0.27
304 0.33