Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BHQ4

Protein Details
Accession G8BHQ4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPENSENKKQNQKQNRRRNQNNDRPRTEGPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, cyto 3, cyto_pero 2.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR017132  Lsm7  
IPR044641  Lsm7/SmG-like  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990726  C:Lsm1-7-Pat1 complex  
GO:0005730  C:nucleolus  
GO:0000932  C:P-body  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0005688  C:U6 snRNP  
GO:0008266  F:poly(U) RNA binding  
GO:0030620  F:U2 snRNA binding  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0030490  P:maturation of SSU-rRNA  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01729  LSm7  
Amino Acid Sequences MPENSENKKQNQKQNRRRNQNNDRPRTEGPKREAILDLNKYKNEEIRVRFVGGRQVTGVLKGYDQLMNLVLEDVKEQFRDPENEGKYLDKTRDLGLVVVRCTSLLTISPVKGSEIIDNPFVSEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.92
4 0.94
5 0.94
6 0.94
7 0.94
8 0.94
9 0.93
10 0.86
11 0.82
12 0.76
13 0.74
14 0.71
15 0.68
16 0.63
17 0.62
18 0.58
19 0.53
20 0.5
21 0.44
22 0.44
23 0.42
24 0.42
25 0.37
26 0.37
27 0.36
28 0.36
29 0.35
30 0.33
31 0.33
32 0.3
33 0.33
34 0.34
35 0.34
36 0.33
37 0.31
38 0.32
39 0.26
40 0.23
41 0.17
42 0.17
43 0.15
44 0.15
45 0.16
46 0.09
47 0.08
48 0.08
49 0.09
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.09
65 0.12
66 0.15
67 0.18
68 0.25
69 0.26
70 0.28
71 0.29
72 0.28
73 0.29
74 0.3
75 0.28
76 0.22
77 0.22
78 0.21
79 0.23
80 0.21
81 0.19
82 0.2
83 0.21
84 0.19
85 0.18
86 0.17
87 0.15
88 0.14
89 0.13
90 0.1
91 0.08
92 0.12
93 0.15
94 0.16
95 0.18
96 0.18
97 0.19
98 0.2
99 0.2
100 0.2
101 0.21
102 0.23
103 0.25
104 0.24