Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SRD3

Protein Details
Accession A0A1L9SRD3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-118RSAAGEKAKPKPKPKPKPKPKPKKKQPSEAQIEREBasic
NLS Segment(s)
PositionSequence
80-125AKTTRSAAGEKAKPKPKPKPKPKPKPKKKQPSEAQIERERVAAIRR
Subcellular Location(s) mito 19, cyto_mito 12, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPFRLAYRTRCVFQHAAAAAAAAPSSVGRVSLASNVRLPSCTVGDHKSVAVLPKILANGFSTTTSRSKAEPDFSTTKTRAKTTRSAAGEKAKPKPKPKPKPKPKPKKKQPSEAQIERERVAAIRREMKELKAAALEPPKKLPMSYFPLAVVDKLPEARNLTENGKEAFKKAIELARNISPEERERLVAAGLSNKAANATAYNEWIKRHTPLQIKEANAARARLRKMGEKAVPLTDDRLVKRLRNSFQFYMQERKESGDFRHMSVLDITSRAAEEWKGLTASEKQEQDRERYYREYLATYGMEPLYVKEESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.36
3 0.32
4 0.28
5 0.27
6 0.2
7 0.17
8 0.15
9 0.06
10 0.06
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.07
17 0.08
18 0.15
19 0.18
20 0.19
21 0.22
22 0.24
23 0.24
24 0.25
25 0.25
26 0.21
27 0.2
28 0.2
29 0.21
30 0.23
31 0.24
32 0.25
33 0.23
34 0.22
35 0.22
36 0.23
37 0.21
38 0.18
39 0.16
40 0.17
41 0.18
42 0.16
43 0.15
44 0.14
45 0.14
46 0.14
47 0.15
48 0.14
49 0.16
50 0.19
51 0.21
52 0.2
53 0.2
54 0.24
55 0.26
56 0.31
57 0.3
58 0.34
59 0.36
60 0.38
61 0.44
62 0.42
63 0.43
64 0.4
65 0.43
66 0.41
67 0.42
68 0.47
69 0.45
70 0.51
71 0.5
72 0.51
73 0.51
74 0.54
75 0.55
76 0.53
77 0.56
78 0.55
79 0.58
80 0.63
81 0.69
82 0.72
83 0.77
84 0.82
85 0.85
86 0.89
87 0.93
88 0.96
89 0.97
90 0.96
91 0.97
92 0.96
93 0.96
94 0.94
95 0.93
96 0.91
97 0.9
98 0.88
99 0.84
100 0.8
101 0.74
102 0.68
103 0.57
104 0.49
105 0.38
106 0.29
107 0.25
108 0.22
109 0.2
110 0.25
111 0.26
112 0.3
113 0.31
114 0.31
115 0.33
116 0.29
117 0.27
118 0.2
119 0.19
120 0.18
121 0.25
122 0.26
123 0.22
124 0.23
125 0.24
126 0.23
127 0.23
128 0.2
129 0.18
130 0.23
131 0.23
132 0.22
133 0.2
134 0.22
135 0.22
136 0.21
137 0.15
138 0.08
139 0.08
140 0.09
141 0.09
142 0.09
143 0.11
144 0.11
145 0.12
146 0.14
147 0.16
148 0.16
149 0.17
150 0.17
151 0.18
152 0.17
153 0.17
154 0.16
155 0.15
156 0.13
157 0.14
158 0.17
159 0.17
160 0.18
161 0.2
162 0.22
163 0.22
164 0.22
165 0.21
166 0.18
167 0.18
168 0.21
169 0.19
170 0.15
171 0.15
172 0.15
173 0.14
174 0.13
175 0.11
176 0.11
177 0.1
178 0.1
179 0.1
180 0.09
181 0.1
182 0.09
183 0.09
184 0.06
185 0.09
186 0.09
187 0.12
188 0.14
189 0.15
190 0.16
191 0.19
192 0.19
193 0.19
194 0.2
195 0.25
196 0.31
197 0.33
198 0.4
199 0.42
200 0.42
201 0.45
202 0.46
203 0.44
204 0.38
205 0.36
206 0.33
207 0.34
208 0.35
209 0.34
210 0.33
211 0.35
212 0.37
213 0.44
214 0.43
215 0.41
216 0.42
217 0.39
218 0.38
219 0.32
220 0.3
221 0.26
222 0.27
223 0.24
224 0.28
225 0.28
226 0.3
227 0.37
228 0.43
229 0.45
230 0.48
231 0.55
232 0.52
233 0.56
234 0.6
235 0.57
236 0.58
237 0.54
238 0.49
239 0.43
240 0.43
241 0.39
242 0.35
243 0.35
244 0.35
245 0.35
246 0.32
247 0.38
248 0.35
249 0.33
250 0.31
251 0.3
252 0.21
253 0.2
254 0.19
255 0.13
256 0.13
257 0.12
258 0.12
259 0.1
260 0.11
261 0.11
262 0.13
263 0.13
264 0.12
265 0.15
266 0.19
267 0.24
268 0.29
269 0.32
270 0.33
271 0.4
272 0.44
273 0.47
274 0.51
275 0.5
276 0.48
277 0.49
278 0.5
279 0.48
280 0.47
281 0.43
282 0.36
283 0.35
284 0.31
285 0.27
286 0.27
287 0.21
288 0.19
289 0.17
290 0.17
291 0.17