Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SFR5

Protein Details
Accession A0A1L9SFR5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-103THKSGGYNKKKSKKRSTRICPLPPFRSHydrophilic
NLS Segment(s)
PositionSequence
85-91KKKSKKR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MKWKWSHLWSRVAFFSCPQPIRQRLQHLSLDSPSLIMIILTLYRLTSDEKKAPSVLRSFKPMKADSSPCFQQPIGATHKSGGYNKKKSKKRSTRICPLPPFRSAWLGKQGMSYLEYYLVASVPSCRNPARWDPTDRPNILREIKFLRQRCCPSLDHGALDAVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.39
4 0.38
5 0.38
6 0.42
7 0.45
8 0.51
9 0.56
10 0.58
11 0.55
12 0.59
13 0.6
14 0.54
15 0.52
16 0.45
17 0.4
18 0.31
19 0.25
20 0.19
21 0.14
22 0.11
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.06
32 0.1
33 0.14
34 0.18
35 0.23
36 0.25
37 0.27
38 0.29
39 0.3
40 0.3
41 0.32
42 0.34
43 0.31
44 0.36
45 0.38
46 0.38
47 0.42
48 0.4
49 0.37
50 0.36
51 0.39
52 0.34
53 0.37
54 0.36
55 0.31
56 0.31
57 0.27
58 0.24
59 0.2
60 0.23
61 0.22
62 0.21
63 0.21
64 0.19
65 0.22
66 0.21
67 0.23
68 0.28
69 0.31
70 0.4
71 0.47
72 0.56
73 0.62
74 0.69
75 0.77
76 0.79
77 0.81
78 0.82
79 0.84
80 0.85
81 0.88
82 0.87
83 0.84
84 0.81
85 0.74
86 0.65
87 0.58
88 0.49
89 0.46
90 0.38
91 0.33
92 0.34
93 0.31
94 0.3
95 0.28
96 0.27
97 0.21
98 0.21
99 0.18
100 0.1
101 0.1
102 0.1
103 0.09
104 0.08
105 0.07
106 0.06
107 0.06
108 0.09
109 0.11
110 0.13
111 0.16
112 0.17
113 0.19
114 0.24
115 0.33
116 0.38
117 0.41
118 0.48
119 0.5
120 0.58
121 0.65
122 0.62
123 0.56
124 0.51
125 0.52
126 0.51
127 0.46
128 0.42
129 0.4
130 0.46
131 0.52
132 0.55
133 0.54
134 0.56
135 0.62
136 0.62
137 0.59
138 0.53
139 0.51
140 0.55
141 0.52
142 0.45
143 0.39
144 0.36