Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SWX6

Protein Details
Accession A0A1L9SWX6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-111CLIRQWRRADKDKNNNHNNNNNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, extr 4, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
PROSITE View protein in PROSITE  
PS01309  UPF0057  
Amino Acid Sequences MPFTASDICKIILAIILPPLGVFLERGCGADLLINICLTILGWLPGIIHALYVFSLPFLPFLPIIYCPPSTGIHLDDNCSRRYRASSIYCLIRQWRRADKDKNNNHNNNNNTSRVSEASGEPGSASAGQTRFNATPLLGGQECSAITNCYCCLDAAESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.09
6 0.09
7 0.07
8 0.07
9 0.06
10 0.05
11 0.09
12 0.09
13 0.1
14 0.11
15 0.1
16 0.1
17 0.12
18 0.12
19 0.1
20 0.11
21 0.1
22 0.09
23 0.08
24 0.08
25 0.06
26 0.06
27 0.05
28 0.04
29 0.05
30 0.05
31 0.05
32 0.06
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.06
48 0.07
49 0.08
50 0.09
51 0.1
52 0.12
53 0.12
54 0.11
55 0.13
56 0.14
57 0.14
58 0.14
59 0.14
60 0.16
61 0.16
62 0.18
63 0.2
64 0.21
65 0.22
66 0.22
67 0.2
68 0.17
69 0.2
70 0.2
71 0.23
72 0.25
73 0.27
74 0.29
75 0.33
76 0.33
77 0.31
78 0.35
79 0.32
80 0.32
81 0.34
82 0.39
83 0.42
84 0.5
85 0.59
86 0.63
87 0.7
88 0.76
89 0.8
90 0.82
91 0.83
92 0.81
93 0.79
94 0.73
95 0.7
96 0.64
97 0.56
98 0.47
99 0.4
100 0.36
101 0.29
102 0.27
103 0.21
104 0.17
105 0.19
106 0.18
107 0.17
108 0.14
109 0.13
110 0.12
111 0.11
112 0.11
113 0.1
114 0.11
115 0.13
116 0.14
117 0.18
118 0.17
119 0.18
120 0.18
121 0.14
122 0.16
123 0.15
124 0.2
125 0.16
126 0.16
127 0.15
128 0.16
129 0.16
130 0.15
131 0.15
132 0.12
133 0.12
134 0.13
135 0.14
136 0.14
137 0.15
138 0.13
139 0.15