Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3BFG0

Protein Details
Accession G3BFG0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
265-284RERILKKKEEDEKKRQAKQLBasic
NLS Segment(s)
PositionSequence
269-279LKKKEEDEKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004130  Gpn  
IPR030230  Gpn1/Npa3/XAB1  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
KEGG cten:CANTEDRAFT_128149  -  
Pfam View protein in Pfam  
PF03029  ATP_bind_1  
CDD cd17870  GPN1  
Amino Acid Sequences MSPATVICIGMAGSGKTTFMQRLNAHLHSKNTPPYVINLDPAVLKIPYGANIDIRDSIKYKQVMEQYNLGPNGAIVTSLNLFSTKIDQVIKLVEKRSESVNNVIVDTPGQIECFIWSASGSIITEAFASTFPTVIAYIVDTPRNTSPTTFMSNMLYACSILYKTKLPMIIVFNKTDAQDAEFAKEWMKDFETFQIAINKDQDMNSEDGSSYMSSLVNSMSLMLEEFYSTLDVVGVSSYTGAGFDDFMDAIDNKVEEYNEFYKAERERILKKKEEDEKKRQAKQLSSLMKDLKIKNGKTASNDGEVLSDLEDEEEDEYNGEVLRDEDEPQREYTFPEDRNSEINSNTDSDLQSRYQAALEATSKTTSSKTAENIAQYIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.14
5 0.17
6 0.18
7 0.26
8 0.26
9 0.33
10 0.39
11 0.43
12 0.47
13 0.47
14 0.49
15 0.46
16 0.51
17 0.51
18 0.47
19 0.44
20 0.38
21 0.38
22 0.41
23 0.38
24 0.34
25 0.27
26 0.25
27 0.23
28 0.22
29 0.21
30 0.13
31 0.11
32 0.11
33 0.11
34 0.13
35 0.16
36 0.17
37 0.18
38 0.19
39 0.21
40 0.24
41 0.24
42 0.23
43 0.22
44 0.23
45 0.27
46 0.28
47 0.28
48 0.3
49 0.37
50 0.4
51 0.41
52 0.45
53 0.41
54 0.44
55 0.43
56 0.37
57 0.29
58 0.23
59 0.21
60 0.14
61 0.12
62 0.05
63 0.07
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.09
70 0.12
71 0.11
72 0.13
73 0.15
74 0.14
75 0.15
76 0.2
77 0.24
78 0.25
79 0.27
80 0.27
81 0.27
82 0.28
83 0.32
84 0.32
85 0.3
86 0.3
87 0.33
88 0.31
89 0.3
90 0.29
91 0.24
92 0.19
93 0.17
94 0.14
95 0.09
96 0.08
97 0.08
98 0.07
99 0.08
100 0.09
101 0.08
102 0.07
103 0.06
104 0.07
105 0.06
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.05
113 0.06
114 0.05
115 0.07
116 0.06
117 0.06
118 0.06
119 0.06
120 0.07
121 0.06
122 0.06
123 0.06
124 0.08
125 0.09
126 0.11
127 0.11
128 0.13
129 0.15
130 0.17
131 0.16
132 0.15
133 0.16
134 0.17
135 0.22
136 0.2
137 0.2
138 0.2
139 0.2
140 0.2
141 0.17
142 0.14
143 0.09
144 0.08
145 0.08
146 0.07
147 0.06
148 0.08
149 0.09
150 0.09
151 0.12
152 0.13
153 0.13
154 0.16
155 0.2
156 0.25
157 0.26
158 0.26
159 0.24
160 0.24
161 0.24
162 0.22
163 0.17
164 0.11
165 0.13
166 0.13
167 0.14
168 0.13
169 0.13
170 0.13
171 0.14
172 0.13
173 0.11
174 0.12
175 0.11
176 0.11
177 0.13
178 0.14
179 0.14
180 0.14
181 0.18
182 0.17
183 0.18
184 0.18
185 0.16
186 0.15
187 0.15
188 0.15
189 0.12
190 0.12
191 0.11
192 0.11
193 0.1
194 0.09
195 0.1
196 0.09
197 0.07
198 0.06
199 0.06
200 0.05
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.04
230 0.04
231 0.05
232 0.05
233 0.05
234 0.06
235 0.06
236 0.06
237 0.07
238 0.06
239 0.06
240 0.07
241 0.07
242 0.06
243 0.12
244 0.14
245 0.16
246 0.17
247 0.17
248 0.21
249 0.23
250 0.26
251 0.26
252 0.28
253 0.35
254 0.43
255 0.5
256 0.52
257 0.54
258 0.6
259 0.65
260 0.71
261 0.72
262 0.73
263 0.77
264 0.79
265 0.83
266 0.8
267 0.76
268 0.7
269 0.68
270 0.68
271 0.65
272 0.58
273 0.56
274 0.53
275 0.5
276 0.52
277 0.46
278 0.46
279 0.46
280 0.44
281 0.46
282 0.49
283 0.48
284 0.47
285 0.52
286 0.46
287 0.41
288 0.41
289 0.33
290 0.28
291 0.26
292 0.21
293 0.15
294 0.11
295 0.07
296 0.07
297 0.07
298 0.06
299 0.07
300 0.07
301 0.07
302 0.07
303 0.07
304 0.08
305 0.08
306 0.07
307 0.06
308 0.06
309 0.08
310 0.09
311 0.11
312 0.16
313 0.2
314 0.22
315 0.24
316 0.26
317 0.24
318 0.25
319 0.29
320 0.31
321 0.3
322 0.33
323 0.33
324 0.33
325 0.36
326 0.39
327 0.35
328 0.29
329 0.3
330 0.27
331 0.27
332 0.26
333 0.25
334 0.21
335 0.21
336 0.23
337 0.21
338 0.22
339 0.21
340 0.2
341 0.18
342 0.19
343 0.18
344 0.19
345 0.2
346 0.2
347 0.21
348 0.21
349 0.21
350 0.21
351 0.21
352 0.21
353 0.22
354 0.24
355 0.26
356 0.31
357 0.35
358 0.37
359 0.39