Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BDP0

Protein Details
Accession G8BDP0   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-107KYTTFSKHSRDYRKPIHRVPKWTKLSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.333, nucl 5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLPSLVRSGGYIWKFTPHVTSTQRVNLRKRSEQVDANIDQIYRGLIQQTGDKKMGDKTGYPKIDHLKFDMPRFNQMSSRDKYTTFSKHSRDYRKPIHRVPKWTKLSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.28
4 0.22
5 0.28
6 0.3
7 0.34
8 0.34
9 0.42
10 0.49
11 0.5
12 0.56
13 0.57
14 0.6
15 0.62
16 0.62
17 0.59
18 0.56
19 0.54
20 0.51
21 0.48
22 0.42
23 0.37
24 0.33
25 0.28
26 0.22
27 0.18
28 0.14
29 0.08
30 0.07
31 0.06
32 0.06
33 0.07
34 0.12
35 0.14
36 0.17
37 0.18
38 0.18
39 0.18
40 0.19
41 0.22
42 0.18
43 0.18
44 0.19
45 0.26
46 0.29
47 0.28
48 0.29
49 0.33
50 0.35
51 0.34
52 0.33
53 0.32
54 0.32
55 0.35
56 0.39
57 0.34
58 0.36
59 0.38
60 0.36
61 0.33
62 0.35
63 0.39
64 0.36
65 0.41
66 0.36
67 0.34
68 0.36
69 0.38
70 0.4
71 0.4
72 0.44
73 0.43
74 0.51
75 0.59
76 0.66
77 0.68
78 0.71
79 0.74
80 0.78
81 0.81
82 0.81
83 0.83
84 0.81
85 0.83
86 0.82
87 0.82
88 0.81
89 0.79
90 0.78
91 0.74
92 0.76
93 0.74
94 0.76