Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SD57

Protein Details
Accession A0A1L9SD57   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-35QTDPEFRKSLKRNNRRLARAVKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_nucl 14.833, nucl 7.5, mito_nucl 4.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences LVAYAVYFDHKRQTDPEFRKSLKRNNRRLARAVKEEAEAQGAMQRETIKAVVQQAKDEGFPTDLEEKEAYFMGQVAKGESLCAEGSANVEAALAFYKALKVYPQPKDLISIYDKTVPKDVLEILAEMVAMDTSLKLGGFTSETGSVDGHGVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.55
4 0.56
5 0.57
6 0.65
7 0.69
8 0.72
9 0.72
10 0.76
11 0.78
12 0.8
13 0.86
14 0.83
15 0.84
16 0.83
17 0.79
18 0.76
19 0.7
20 0.61
21 0.53
22 0.48
23 0.4
24 0.32
25 0.24
26 0.16
27 0.15
28 0.13
29 0.12
30 0.12
31 0.12
32 0.1
33 0.11
34 0.12
35 0.09
36 0.11
37 0.17
38 0.21
39 0.21
40 0.21
41 0.22
42 0.22
43 0.21
44 0.2
45 0.15
46 0.1
47 0.1
48 0.12
49 0.13
50 0.13
51 0.14
52 0.14
53 0.13
54 0.13
55 0.13
56 0.1
57 0.06
58 0.07
59 0.06
60 0.06
61 0.07
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.06
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.05
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.06
86 0.07
87 0.12
88 0.2
89 0.26
90 0.29
91 0.3
92 0.3
93 0.34
94 0.33
95 0.32
96 0.27
97 0.23
98 0.22
99 0.28
100 0.29
101 0.27
102 0.3
103 0.26
104 0.23
105 0.23
106 0.22
107 0.17
108 0.16
109 0.15
110 0.11
111 0.11
112 0.1
113 0.08
114 0.07
115 0.05
116 0.04
117 0.04
118 0.03
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.08
126 0.08
127 0.11
128 0.13
129 0.13
130 0.14
131 0.14
132 0.14