Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SRW3

Protein Details
Accession A0A1L9SRW3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-64GEVRNKKKSRREVTKYGGLEBasic
NLS Segment(s)
PositionSequence
48-55RNKKKSRR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences TDNRVKTSHESQPRPPGEKAEWGYQKVEGRMNRRGESAELRQTGGEVRNKKKSRREVTKYGGLEEQEERRARDGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.61
3 0.57
4 0.5
5 0.53
6 0.49
7 0.47
8 0.46
9 0.42
10 0.42
11 0.4
12 0.4
13 0.34
14 0.36
15 0.31
16 0.32
17 0.37
18 0.41
19 0.38
20 0.36
21 0.35
22 0.31
23 0.31
24 0.3
25 0.28
26 0.25
27 0.24
28 0.23
29 0.22
30 0.22
31 0.22
32 0.24
33 0.25
34 0.3
35 0.4
36 0.46
37 0.53
38 0.6
39 0.66
40 0.71
41 0.75
42 0.78
43 0.77
44 0.79
45 0.81
46 0.73
47 0.65
48 0.57
49 0.47
50 0.42
51 0.36
52 0.33
53 0.31
54 0.33
55 0.32