Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SV85

Protein Details
Accession A0A1L9SV85    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
42-72MDSERERRNRESNFQRRRRRSQRLDVKIGHGBasic
NLS Segment(s)
PositionSequence
57-61RRRRR
Subcellular Location(s) cyto 14.5, cyto_nucl 11.833, nucl 8, mito_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR002501  PsdUridine_synth_N  
IPR014780  tRNA_psdUridine_synth_TruB  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01509  TruB_N  
Amino Acid Sequences MSGEKIYEGVFAVHKPTGISSADVLRDLQKHFNPSALFKPWMDSERERRNRESNFQRRRRRSQRLDVKIGHGGTLDPMATGVLVAGVGKGTKYLQNFLGCTKTYETVILFGAETDTYDRMGKIVRRGPYEHVTREAVEKALEQFRGKIMQHPPIFSALKVQGKKLYEYAREGKEPPIEIKARPVEVTNLEIVEWYEPGTHEYKWPEEEMVGEERAVAERLLAKDDALPAVPSVDDVDLEKGEQGAPLKRKPSAAGEEVAPTTESASDPSTTADPAPSAKKQKVSAEEESVEVEKQSVQMDETKSAEPGADSTTANRPPPPAVKLTMTVSSGFYVRSLAHDLGKALGTCGIMSSLIRSRQATFELHPDKVLEYADLEAGEDVWGPKVKGFLDEWEKKRAAEEDANDQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.18
5 0.18
6 0.18
7 0.17
8 0.21
9 0.22
10 0.22
11 0.22
12 0.23
13 0.26
14 0.27
15 0.33
16 0.32
17 0.37
18 0.37
19 0.4
20 0.38
21 0.39
22 0.42
23 0.4
24 0.39
25 0.33
26 0.36
27 0.36
28 0.37
29 0.39
30 0.4
31 0.44
32 0.53
33 0.62
34 0.64
35 0.66
36 0.71
37 0.71
38 0.74
39 0.75
40 0.75
41 0.76
42 0.81
43 0.86
44 0.87
45 0.92
46 0.92
47 0.92
48 0.91
49 0.91
50 0.92
51 0.91
52 0.9
53 0.83
54 0.77
55 0.71
56 0.61
57 0.5
58 0.39
59 0.3
60 0.21
61 0.19
62 0.14
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.06
78 0.1
79 0.12
80 0.15
81 0.19
82 0.22
83 0.23
84 0.25
85 0.28
86 0.25
87 0.26
88 0.26
89 0.23
90 0.2
91 0.21
92 0.19
93 0.16
94 0.15
95 0.13
96 0.11
97 0.09
98 0.09
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.13
108 0.16
109 0.21
110 0.26
111 0.3
112 0.33
113 0.36
114 0.41
115 0.44
116 0.47
117 0.42
118 0.4
119 0.37
120 0.34
121 0.34
122 0.29
123 0.22
124 0.17
125 0.16
126 0.16
127 0.18
128 0.19
129 0.16
130 0.16
131 0.17
132 0.22
133 0.21
134 0.25
135 0.26
136 0.33
137 0.34
138 0.34
139 0.34
140 0.34
141 0.34
142 0.27
143 0.27
144 0.23
145 0.28
146 0.28
147 0.29
148 0.28
149 0.29
150 0.3
151 0.3
152 0.3
153 0.26
154 0.31
155 0.36
156 0.34
157 0.35
158 0.35
159 0.34
160 0.31
161 0.3
162 0.25
163 0.25
164 0.24
165 0.22
166 0.26
167 0.25
168 0.24
169 0.23
170 0.22
171 0.19
172 0.18
173 0.19
174 0.13
175 0.11
176 0.1
177 0.1
178 0.09
179 0.07
180 0.06
181 0.05
182 0.05
183 0.05
184 0.07
185 0.09
186 0.09
187 0.11
188 0.13
189 0.14
190 0.15
191 0.15
192 0.13
193 0.12
194 0.12
195 0.11
196 0.12
197 0.11
198 0.09
199 0.09
200 0.09
201 0.09
202 0.09
203 0.06
204 0.05
205 0.07
206 0.08
207 0.1
208 0.09
209 0.09
210 0.1
211 0.1
212 0.1
213 0.08
214 0.08
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.07
230 0.08
231 0.13
232 0.17
233 0.21
234 0.23
235 0.24
236 0.25
237 0.26
238 0.3
239 0.3
240 0.28
241 0.26
242 0.25
243 0.25
244 0.24
245 0.22
246 0.16
247 0.11
248 0.09
249 0.08
250 0.07
251 0.07
252 0.09
253 0.09
254 0.09
255 0.1
256 0.1
257 0.1
258 0.1
259 0.09
260 0.09
261 0.11
262 0.15
263 0.19
264 0.25
265 0.28
266 0.32
267 0.36
268 0.41
269 0.47
270 0.49
271 0.48
272 0.47
273 0.44
274 0.4
275 0.38
276 0.32
277 0.25
278 0.18
279 0.14
280 0.09
281 0.09
282 0.1
283 0.08
284 0.09
285 0.13
286 0.15
287 0.18
288 0.2
289 0.2
290 0.19
291 0.19
292 0.18
293 0.13
294 0.12
295 0.12
296 0.11
297 0.11
298 0.13
299 0.2
300 0.23
301 0.25
302 0.25
303 0.24
304 0.27
305 0.32
306 0.33
307 0.3
308 0.3
309 0.31
310 0.32
311 0.34
312 0.32
313 0.28
314 0.26
315 0.23
316 0.2
317 0.18
318 0.15
319 0.12
320 0.11
321 0.1
322 0.12
323 0.15
324 0.16
325 0.17
326 0.18
327 0.19
328 0.19
329 0.2
330 0.18
331 0.14
332 0.14
333 0.12
334 0.11
335 0.11
336 0.1
337 0.08
338 0.08
339 0.12
340 0.15
341 0.18
342 0.21
343 0.23
344 0.24
345 0.27
346 0.3
347 0.3
348 0.27
349 0.34
350 0.36
351 0.35
352 0.34
353 0.32
354 0.3
355 0.28
356 0.26
357 0.16
358 0.12
359 0.13
360 0.13
361 0.12
362 0.11
363 0.1
364 0.09
365 0.09
366 0.08
367 0.08
368 0.1
369 0.13
370 0.13
371 0.14
372 0.17
373 0.17
374 0.2
375 0.21
376 0.26
377 0.34
378 0.44
379 0.46
380 0.52
381 0.52
382 0.49
383 0.51
384 0.45
385 0.42
386 0.4
387 0.41