Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SW45

Protein Details
Accession A0A1L9SW45    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-42QQGSPKKPQKPLHTGRKSKPBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAIKNLKNAGMPVPPQAAGIASQQGSPKKPQKPLHTGRKSKPGNAVQSSTTQPPTAQLPTFGSLKSMLEDPEFKKLSKARRGEEIASLRNLGWPHLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.18
5 0.14
6 0.14
7 0.14
8 0.12
9 0.13
10 0.17
11 0.2
12 0.22
13 0.28
14 0.35
15 0.38
16 0.48
17 0.54
18 0.59
19 0.66
20 0.74
21 0.77
22 0.79
23 0.81
24 0.76
25 0.79
26 0.72
27 0.65
28 0.64
29 0.59
30 0.56
31 0.5
32 0.47
33 0.38
34 0.39
35 0.37
36 0.3
37 0.24
38 0.17
39 0.14
40 0.14
41 0.15
42 0.15
43 0.13
44 0.13
45 0.14
46 0.16
47 0.17
48 0.16
49 0.14
50 0.12
51 0.13
52 0.12
53 0.11
54 0.1
55 0.11
56 0.15
57 0.16
58 0.24
59 0.25
60 0.24
61 0.29
62 0.33
63 0.41
64 0.46
65 0.51
66 0.46
67 0.54
68 0.59
69 0.55
70 0.59
71 0.56
72 0.51
73 0.46
74 0.44
75 0.35
76 0.33
77 0.31