Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9SDQ5

Protein Details
Accession A0A1L9SDQ5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-71KPVPAPPKRKPGRPPKAAKKVKAEEDEBasic
NLS Segment(s)
PositionSequence
48-66PAPPKRKPGRPPKAAKKVK
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MPMTWDSTADAKLLLAILDQMRTSQMKLDYKEIAAYMGPAEGDEKPVPAPPKRKPGRPPKAAKKVKAEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.05
3 0.07
4 0.07
5 0.08
6 0.08
7 0.08
8 0.1
9 0.1
10 0.11
11 0.12
12 0.17
13 0.21
14 0.23
15 0.26
16 0.26
17 0.25
18 0.25
19 0.22
20 0.17
21 0.11
22 0.1
23 0.06
24 0.05
25 0.05
26 0.04
27 0.05
28 0.05
29 0.08
30 0.08
31 0.09
32 0.09
33 0.13
34 0.17
35 0.21
36 0.29
37 0.33
38 0.44
39 0.5
40 0.58
41 0.64
42 0.72
43 0.77
44 0.8
45 0.84
46 0.84
47 0.89
48 0.9
49 0.87
50 0.86
51 0.84
52 0.83