Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9S497

Protein Details
Accession A0A1L9S497    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-122RDMANERVKKKKGKKRNRGQRSKYKSKSSTRGRSNGBasic
NLS Segment(s)
PositionSequence
92-120ERVKKKKGKKRNRGQRSKYKSKSSTRGRS
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSDRGARNLPSFRLLGRSGQVCSQRPTDKTGQHERKVQVSGSSFHSPCTQQRIPQELNRWVDYRKPDSERSLREQKQKVSPERMFARDMANERVKKKKGKKRNRGQRSKYKSKSSTRGRSNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.27
4 0.27
5 0.25
6 0.3
7 0.35
8 0.33
9 0.35
10 0.39
11 0.4
12 0.39
13 0.44
14 0.46
15 0.44
16 0.48
17 0.56
18 0.59
19 0.58
20 0.64
21 0.6
22 0.57
23 0.54
24 0.47
25 0.4
26 0.33
27 0.3
28 0.29
29 0.32
30 0.27
31 0.26
32 0.28
33 0.26
34 0.26
35 0.32
36 0.28
37 0.26
38 0.31
39 0.37
40 0.38
41 0.4
42 0.44
43 0.42
44 0.43
45 0.41
46 0.38
47 0.31
48 0.32
49 0.32
50 0.31
51 0.29
52 0.3
53 0.31
54 0.36
55 0.42
56 0.43
57 0.46
58 0.51
59 0.52
60 0.57
61 0.59
62 0.58
63 0.6
64 0.64
65 0.63
66 0.62
67 0.58
68 0.57
69 0.56
70 0.54
71 0.47
72 0.4
73 0.36
74 0.31
75 0.33
76 0.32
77 0.35
78 0.37
79 0.4
80 0.48
81 0.51
82 0.57
83 0.64
84 0.68
85 0.71
86 0.78
87 0.85
88 0.88
89 0.93
90 0.95
91 0.95
92 0.95
93 0.95
94 0.94
95 0.94
96 0.91
97 0.91
98 0.88
99 0.87
100 0.87
101 0.87
102 0.87